2. Peptides
  3. Peptide and Derivatives
  4. Therapeutic Peptides
  5. Urodilatin

Urodilatin is an analogue of ANF-(99-126). Urodilatin is a diuretic-natriuretic regulatory peptide. Urodilatin can be used for research of acute renal failure, congestive heart failure, and bronchial asthma, etc.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Urodilatin Chemical Structure

Urodilatin Chemical Structure

CAS No. : 115966-23-9

Size Price Stock Quantity
500 μg USD 1140 Get quote 3 - 4 weeks 4 - 5 weeks 2 - 3 weeks
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Urodilatin Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Urodilatin is an analogue of ANF-(99-126). Urodilatin is a diuretic-natriuretic regulatory peptide. Urodilatin can be used for research of acute renal failure, congestive heart failure, and bronchial asthma, etc[1].

Molecular Weight

3507.94

Formula

C145H236N52O44S3
CAS No.
Sequence

Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr
Sequence Shortening

TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Urodilatin Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Urodilatin115966-23-9OthersDiureticpeptideacute renal failurecongestive heart failureInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Urodilatin
Cat. No.:
HY-120521
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.