1. Induced Disease Models Products Neuronal Signaling
  2. Nervous System Disease Models Amyloid-β
  3. Alzheimer's Disease Models
  4. β-Amyloid (1-40) TFA

β-Amyloid (1-40) TFA  (Synonyms: Amyloid Beta-Peptide (1-40) (human) TFA; Amyloid β-Peptide (1-40) (human) TFA)

Cat. No.: HY-P0265A Purity: 99.89%
Handling Instructions Technical Support

β-Amyloid (1-40) TFA is a primary protein in plaques found in the brains of patients with Alzheimer's disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Amyloid (1-40) TFA Chemical Structure

β-Amyloid (1-40) TFA Chemical Structure

Size Price Stock Quantity
500 μg In-stock
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 8 publication(s) in Google Scholar

Other Forms of β-Amyloid (1-40) TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

β-Amyloid (1-40) TFA is a primary protein in plaques found in the brains of patients with Alzheimer's disease[1].

In Vitro

β-Amyloid (1-40) and (1-42) are major components of senile plaque amyloids, are physiological peptides present in the brain, cerebrospinal fluid (CSF) and plasma. The levels of CSF β-Amyloid (1-40) and (1-42) show a U-shaped natural course in normal aging[1].
The further aggregation of β-Amyloid (1-40)
1. Solid Aβ peptide was dissolved in cold hexafluoro-2-propanol (HFIP). The peptide was incubated at room temperature for at least 1h to establish monomerization and randomization of structure.
2. The HFIP was removed by evaporation, and the resulting peptide was stored as a film at -20 or -80°C.
3. The resulting film was dissolved in anhydrous DMSO at 5 mM and then diluted into the appropriate concentration and buffer (serum- and phenol red-free culture medium) with vortexing.
4. Next, the solution was age 48h at 4-8°C. The sample was then centrifuged at 14000g for 10 min at 4-8°C; the soluble oligomers were in the supernatant. The supernatant was diluted 10-200-fold for experiments.
Methods vary depends on the downstream applications.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

β-Amyloid (1-40) can be used in animal modeling to create Alzheimer's disease models.

Induction of Alzheimer's disease[2]
Background
β-Amyloid (1-40) induces Alzheimer's disease by accumulating in the brain and being neurotoxic.
Specific Modeling Methods
Rat: Wistar • male • 280-320 g
Administration: 0, 3, 30, 300 pmol • connection of cannulae to modified micro-osmotic pumps for infusion • 2 weeks
Note
(1) Dissolve β-Amyloid (1-40) in 35% acetonitrile/0.1% trifluoroacetic acid (TFA).
(2) In each group of 7 rats, a catheter was placed into the left ventricle on day 1. A water maze task was performed on days 9-13 after the start of infusion. At the end of the behavioural experiments, 4 rats from each group were taken from each group and processed by severing their heads for ChAT activity assay. Three rats were taken for histochemical studies.
(3) In histochemical studies, rats were anaesthetised and executed by transaortic perfusion fixation, first in cold saline and then in 4% paraformaldehyde and 0.1 M sodium phosphate buffer. Brains were removed and fixed in the same fixative for 12 hours. Frozen brain tissue was cut at 20 μm using a cryostat and the periventricular region was collected.
Modeling Indicators
Molecular changes: The activity of acetyltransferase (ChAT) in the frontal cortex and hippocampus is reduced, and cholinergic neuron dysfunction occurs.
Organizational changes: Accumulation of β-Amyloid in the hippocampus and cerebral cortex.
Phenotypic observation: Memory impairment occurs.
Correlated Product(s): /
Opposite Product(s): /

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4443.84

Formula

C194H295N53O58S.C2HF3O2

Appearance

Solid

Color

White to off-white

Sequence

Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Sequence Shortening

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*The compound is unstable in solutions, freshly prepared is recommended.

Solvent & Solubility
In Vitro: 

H2O : 100 mg/mL (22.50 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2250 mL 1.1252 mL 2.2503 mL
5 mM 0.0450 mL 0.2250 mL 0.4501 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 99.89%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2250 mL 1.1252 mL 2.2503 mL 5.6258 mL
5 mM 0.0450 mL 0.2250 mL 0.4501 mL 1.1252 mL
10 mM 0.0225 mL 0.1125 mL 0.2250 mL 0.5626 mL
15 mM 0.0150 mL 0.0750 mL 0.1500 mL 0.3751 mL
20 mM 0.0113 mL 0.0563 mL 0.1125 mL 0.2813 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-Amyloid (1-40) TFA
Cat. No.:
HY-P0265A
Quantity:
MCE Japan Authorized Agent: