β-Amyloid (1-40) 

β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease.

β-Amyloid (1-40) and (1-42) are major components of senile plaque amyloids, are physiological peptides present in the brain, cerebrospinal fluid (CSF) and plasma. The levels of CSF β-Amyloid (1-40) and (1-42) show a U-shaped natural course in normal aging^[1].Chronic infusion of beta-amyloid (1-40) for 14 days into the rat cerebroventricle decreased the activity of soluble protein kinase C (PKC) in the hippocampus. Subcellular translocation of PKC to membrane fraction in hippocampal slices of rats treated with beta-amyloid (1-40) is completely abolished under acute stimulation with 0.5 microM phorbol-dibutyrate (PDBu)^[2].
The further aggregation of β-Amyloid (1-40)
1. Solid Aβ peptide was dissolved in cold hexafluoro-2-propanol (HFIP). The peptide was incubated at room temperature for at least 1h to establish monomerization and randomization of structure.
2. The HFIP was removed by evaporation, and the resulting peptide was stored as a film at -20 or -80°C.
3. The resulting film was dissolved in anhydrous DMSO at 5 mM and then diluted into the appropriate concentration and buffer (serum- and phenol red-free culture medium) with vortexing.
4. Next, the solution was age 48h at 4-8°C. The sample was then centrifuged at 14000g for 10 min at 4-8°C; the soluble oligomers were in the supernatant. The supernatant was diluted 10-200-fold for experiments.
Methods vary depends on the downstream applications.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Chronic infusion of β-Amyloid (1-40) into rat cerebroventricle leads to deficit in spatial and non-spatial memory formation^[2]. Chronic treatment of β-Amyloid (1-40) does not change lever-pressing performance significantly, but performance declined significantly 30 days after termination of the chronic daily regimen. The soluble unaggregated form of β-Amyloid (1-40), injected into the dorsal hippocampus, does not appear to have behavioral effects on performance or short-term working memory in rats, but multiple repeat injections produced performance decrements several weeks later. Repeated injection of β-Amyloid (1-40) through indwelling cannulae shows promise for development of an animal model of Alzheimer's disease^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4329.82

C₁₉₄H₂₉₅N₅₃O₅₈S

131438-79-4

Solid

White to off-white

Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*The compound is unstable in solutions, freshly prepared is recommended.

* Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

• [1]. Shoji M, et al. Cerebrospinal fluid Abeta40 and Abeta42: natural course and clinical usefulness. Front Biosci. 2002 Apr 1;7:d997-1006.  [Content Brief]

  [2]. Cleary J, et al. Beta-amyloid(1-40) effects on behavior and memory. Brain Res. 1995 Jun 5;682(1-2):69-74.  [Content Brief]

  [3]. Olariu A, et al. Memory impairment induced by chronic intracerebroventricular infusion of beta-amyloid (1-40) involves downregulation of protein kinase C. Brain Res. 2002 Dec 13;957(2):278-86.  [Content Brief]