β-Amyloid-¹⁵N (1-42), human TFA (Synonyms: Amyloid β-peptide-¹⁵N (1-42) (human) TFA)

Cat. No.: HY-P1363S: FAQs
Data Sheet Handling Instructions

Molarity Calculator

β-Amyloid-¹⁵N (1-42), human (TFA) is the ¹⁵N-labledβ-Amyloid (1-42) (TFA). β-Amyloid (1-42), human TFA (Amyloid β-Peptide (1-42) (human) TFA) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease[1].

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Amyloid-<sup>15</sup>N (1-42), human TFA Chemical Structure

β-Amyloid-¹⁵N (1-42), human TFA Chemical Structure

Size		Stock
1 mg		Get quote	Estimated Time of Arrival: December 31

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of β-Amyloid-¹⁵N (1-42), human TFA:

β-Amyloid (1-42), human TFA In-stock
5-FAM-β-Amyloid (1-42), human Get quote
Biotin-β-Amyloid (1-42), human TFA Get quote
5-FAM-β-Amyloid (1-42), human TFA Get quote

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description	β-Amyloid-¹⁵N (1-42), human (TFA) is the ¹⁵N-labledβ-Amyloid (1-42) (TFA). β-Amyloid (1-42), human TFA (Amyloid β-Peptide (1-42) (human) TFA) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease[1].
In Vitro	Stable heavy isotopes of hydrogen, carbon, and other elements have been incorporated into drug molecules, largely as tracers for quantitation during the drug development process. Deuteration has gained attention because of its potential to affect the pharmacokinetic and metabolic profiles of drugs^[2]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. β-Amyloid-¹⁵N (1-42), human TFA Related Antibodies
Molecular Weight	4515.10 (free acid)
Formula	C₂₀₃H₃₁₁N₅₄¹⁵NO₆₀S.xC₂HF₃O₂
Unlabeled CAS	107761-42-2
Sequence	Asp-Ala-{Glu-15N}-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala (TFA)
Sequence Shortening	DA-{Glu-15N}-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (284 KB) Handling Instructions (2659 KB)
References	[1]. Solntseva EI, et al. Impact of amyloid-β peptide (1-42) on voltage-gated ion currents in molluscan neurons. Bull Exp Biol Med. 2011 Oct;151(6):671-4. [Content Brief] [2]. Russak EM, et al. Impact of Deuterium Substitution on the Pharmacokinetics of Pharmaceuticals. Ann Pharmacother. 2019;53(2):211-216. [Content Brief]

β-Amyloid-¹⁵N (1-42), human TFA Related Classifications

Neurological Disease

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

β-Amyloid-¹⁵N (1-42), humanAmyloid β-peptide-¹⁵N (1-42) (human)Amyloid-ββ-amyloid peptideAβAbetaInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name

Lot #

Applicant Name *

Email Address *

Phone Number

Department *

Organization Name *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

β-Amyloid-15N (1-42), human TFA (Synonyms: Amyloid β-peptide-15N (1-42) (human) TFA)

Other Forms of β-Amyloid-15N (1-42), human TFA:

β-Amyloid-15N (1-42), human TFA Related Antibodies

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity

Purity & Documentation

References

Customer Review