1. GPCR/G Protein
  2. PACAP Receptor
  3. PACAP (1-38), human, ovine, rat

PACAP (1-38), human, ovine, rat  (Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide 38)

Cat. No.: HY-P0221 Purity: 99.88%
Handling Instructions Technical Support

PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

PACAP (1-38), human, ovine, rat Chemical Structure

PACAP (1-38), human, ovine, rat Chemical Structure

CAS No. : 137061-48-4

Size Price Stock Quantity
500 μg In-stock
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 4 publication(s) in Google Scholar

Other Forms of PACAP (1-38), human, ovine, rat:

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.

IC50 & Target

IC50: 4 nM (PACAP type I receptor), 2 nM (PACAP type II receptor VIP1), and 1 nM (PACAP type II receptor VIP2)[1]

In Vitro

PACAP (1-38), human, ovine, rat is a fragment of pituitary adenylate cyclase activating polypeptide[1].
PACAP (1-38) shows high affinity for PACAP specific (PAC1) receptor in membranes from various tissues including the endocrine pancreas[2].
In vitro, PACAP (1-38) relaxes guinea-pig and rabbit tracheal smooth muscle precontracted by histamine and by acetylcholine. PACAP (1-38) also increases adenosine 3':5'-cyclic monophosphate (cyclic AMP) in tracheal smooth muscle, providing a possible mechanism for the relaxant effect of PACAP (1-38)[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

PACAP (1-38) alone in sham animals does not result in changes in any of the retinal layers. PACAP (1-38) dissolved in solutio ophthalmica cum benzalkonio leads to significant protection in the retina in bilateral common carotid artery occlusion (BCCAO)-lesioned retinas; retinas treated with PACAP (1-38) eye drops have preserved structure compared to control retinas. OLM-ILM (outer limiting membrane-inner limiting membrane) distance is reduced by 49.7% (p<0.001) in BCCAO retinas compared to sham controls, but it is only 40.6% (p<0.001) in the eyes treated with PACAP (1-38) eye drops. A protection to a similar degree is found in the inner nuclear layer (INL) (BCCAO: 38.5%, PACAP (1-38): 30.5%; p<0.001), and inner plexiform layer (IPL) (BCCAO: 64.8%, PACAP (1-38): 38.2%; p<0.05), while no statistically significant attenuation of the damage is observed in the outer nuclear layer (ONL) (BCCAO: 36.5%, PACAP (1-38): 37.7%) or outer plexiform layer (OPL) (BCCAO: 53.0%, PACAP (1-38): 48.2%). The number of cells in the ganglion cell layer (GCL) is significantly decreased after BCCAO by 52.4% (p<0.05) and is significantly ameliorated by PACAP (1-38) eye drops (decreased by 25.9%; p<0.05)[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4534.26

Formula

C203H331N63O53S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2

Sequence Shortening

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : 25 mg/mL (5.51 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2205 mL 1.1027 mL 2.2054 mL
5 mM 0.0441 mL 0.2205 mL 0.4411 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 99.88%

References
Animal Administration
[4]

Rats[4]
Wistar rats (n=20:n=12 for histological analysis, n=8 for immunohistochemical analysis) weighing 250-300 are fed and watered ad libitum, under light/dark cycles of 12/12 h. Directly after the operation within 1 min, the right eye is treated with PACAP (1-38) eye drops (1 µg/drop). The vehicle used is benzalkonium-chloride in a concentration of 0.005%, as it is the most effective vehicle to achieve neuroprotection with PACAP1-27 eye drops. The left eye serves as a control, treated only with the vehicle. A group of animals serve as the sham-operated group that undergo anesthesia and all steps of the surgical procedure except ligation of the carotid arteries. Rats are treated twice a day with one drop, for 5 consecutive days[4].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2205 mL 1.1027 mL 2.2054 mL 5.5136 mL
5 mM 0.0441 mL 0.2205 mL 0.4411 mL 1.1027 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PACAP (1-38), human, ovine, rat
Cat. No.:
HY-P0221
Quantity:
MCE Japan Authorized Agent: