PACAP (1-38) free acid TFA

Cat. No.: HY-P0221B: FAQs
Data Sheet Handling Instructions

Molarity Calculator

PACAP (1-38) free acid TFA is an endogenous neuropeptide. PACAP (1-38) free acid TFA potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid TFA also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1.

For research use only. We do not sell to patients.

PACAP (1-38) free acid TFA Chemical Structure

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of PACAP (1-38) free acid TFA:

PACAP (1-38), human, ovine, rat Get quote
PACAP (1-38) free acid Get quote

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vitro

PACAP (1-38) free acid TFA (1 nM) increases substance P, gastrin releasing peptide and vasoactive intestinal polypeptide release^[1].
PACAP (1-38) free acid TFA (100 nM; 10 min) induces tyrosine phosphorylation of NR2B in rat hippocampal slices^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Western Blot Analysis^[2]

Cell Line:	Rat hippocampal slices
Concentration:	100 nM
Incubation Time:	10 min
Result:	Caused an enhancement of tyrosine phosphorylation of NR2B.

Molecular Weight

4649.26

Formula

C₂₀₅H₃₃₁F₃N₆₂O₅₆S

Sequence

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys

Sequence Shortening

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKR YKQRVKNK

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Handling Instructions (2659 KB)

References

[1]. Tornøe K, et al. PACAP 1-38 as neurotransmitter in the porcine antrum. Regul Pept. 2001 Sep 15;101(1-3):109-21. [Content Brief]

[2]. Yaka R, et al. Pituitary adenylate cyclase-activating polypeptide (PACAP(1-38)) enhances N-methyl-D-aspartate receptor function and brain-derived neurotrophic factor expression via RACK1. J Biol Chem. 2003 Mar 14;278(11):9630-8. [Content Brief]