PACAP (1-38) free acid

Name: PACAP (1-38) free acid
Brand: MedChemExpress
SKU: HY-P0221C
Rating: 4.5 (1 reviews)

Cat. No.: HY-P0221C Purity: 99.84%: FAQs
Data Sheet SDS COA Handling Instructions Technical Support

PACAP (1-38) free acid is an endogenous neuropeptide. PACAP (1-38) free acid potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

PACAP (1-38) free acid Chemical Structure

CAS No. : 129405-61-4

Size	Stock	Quantity
1 mg	In-stock	Estimated Time of Arrival: December 31
5 mg	In-stock	Estimated Time of Arrival: December 31
10 mg	Get quote
50 mg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of PACAP (1-38) free acid:

PACAP (1-38), human, ovine, rat Get quote
PACAP (1-38) free acid TFA Get quote

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vitro

PACAP (1-38) free acid (1 nM) increases substance P, gastrin releasing peptide and vasoactive intestinal polypeptide release^[1].
PACAP (1-38) free acid (100 nM; 10 min) induces tyrosine phosphorylation of NR2B in rat hippocampal slices^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Western Blot Analysis^[2]

Cell Line:	Rat hippocampal slices
Concentration:	100 nM
Incubation Time:	10 min
Result:	Caused an enhancement of tyrosine phosphorylation of NR2B.

Molecular Weight

4535.24

Formula

C₂₀₃H₃₃₀N₆₂O₅₄S

CAS No.

129405-61-4

Appearance

Solid

Color

White to off-white

Sequence

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys

Sequence Shortening

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

DMSO : 100 mg/mL (22.05 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2205 mL	1.1025 mL	2.2050 mL
5 mM	0.0441 mL	0.2205 mL	0.4410 mL
10 mM	0.0220 mL	0.1102 mL	0.2205 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

Purity & Documentation

Purity: 99.84%

Select Batch:

Data Sheet (270 KB) SDS (252 KB)

COA (243 KB) RP-HPLC (244 KB) MS (84 KB)

Handling Instructions (2659 KB)

References

[1]. Tornøe K, et al. PACAP 1-38 as neurotransmitter in the porcine antrum. Regul Pept. 2001 Sep 15;101(1-3):109-21. [Content Brief]

[2]. Yaka R, et al. Pituitary adenylate cyclase-activating polypeptide (PACAP(1-38)) enhances N-methyl-D-aspartate receptor function and brain-derived neurotrophic factor expression via RACK1. J Biol Chem. 2003 Mar 14;278(11):9630-8. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

DMSO	1 mM	0.2205 mL	1.1025 mL	2.2050 mL	5.5124 mL
	5 mM	0.0441 mL	0.2205 mL	0.4410 mL	1.1025 mL
	10 mM	0.0220 mL	0.1102 mL	0.2205 mL	0.5512 mL
	15 mM	0.0147 mL	0.0735 mL	0.1470 mL	0.3675 mL
	20 mM	0.0110 mL	0.0551 mL	0.1102 mL	0.2756 mL