2. Signaling Pathways
  3. Membrane Transporter/Ion Channel
    Neuronal Signaling
  4. iGluR

iGluR

Ionotropic glutamate receptors

iGluR

Related Products

PDF 3.65 MB

iGluR (ionotropic glutamate receptor) is a ligand-gated ion channel that is activated by the neurotransmitter glutamate. iGluR are integral membrane proteins compose of four large subunits that form a central ion channel pore. Sequence similarity among all known glutamate receptor subunits, including the AMPA, kainate, NMDA, and δ receptors.

AMPA receptors are the main charge carriers during basal transmission, permitting influx of sodium ions to depolarise the postsynaptic membrane. NMDA receptors are blocked by magnesium ions and therefore only permit ion flux following prior depolarisation. This enables them to act as coincidence detectors for synaptic plasticity. Calcium influx through NMDA receptors leads to persistent modifications in the strength of synaptic transmission.

iGluR Isoform Specific Products:

iGluR Isoform Comparison
Cat. No. Product Name Effect Purity Chemical Structure
  • HY-B1270A
    Isoxsuprine
    		Antagonist
    Isoxsuprine is a beta-adrenergic receptor agonist with Kis of 13.65 μΜ and 3.48 μΜ for myometrial and placcntal beta-adrenergic receptor, respectively. Isoxsuprine hydrochloride is also a NMDA receptor antagonist.
    Isoxsuprine
  • HY-B0369AR
    Orphenadrine (citrate) (Standard)
    		Antagonist
    Orphenadrine (citrate) (Standard) is the analytical standard of Orphenadrine (citrate). This product is intended for research and analytical applications. Orphenadrine citrate is an orally active and non-competitive NMDA receptor antagonist (crosses the blood-brain barrier) with a Ki of 6.0 μM. Orphenadrine citrate relieves stiffness, pain and discomfort due to muscle strains, sprains or other injuries. Orphenadrine citrate is also used to relieve tremors associated with parkinson's disease. Orphenadrine citrate has good neuroprotective properties, can be used in studies of neurodegenerative diseases.
    Orphenadrine (citrate) (Standard)
  • HY-P10401
    TAT-GluR6-9c
    		Antagonist
    TAT-GluR6-9c is a GluR6-PSD95 interaction blocker. By regulating the GluR6 mediated signaling pathway, TAT-GluR6-9c inhibits the activation of JNK and phosphorylation of c-Jun, reduces the expression of Fas L and thus reduces the occurrence of apoptosis. TAT-GluR6-9c can be used to study cerebral ischemia and neuroprotective strategies .
    TAT-GluR6-9c
  • HY-19465
    Dasolampanel
    		Antagonist
    Dasolampanel is a kainate receptor antagonist that helps regulate the excitability of the nervous system by blocking kainate receptors and reducing glutamate-mediated excitatory transmission. Dasolampanel can be used in the study of diseases such as overexcitement and sleep disorders.
    Dasolampanel
  • HY-100998A
    Metaphit methylsulfate
    		Antagonist
    Metaphit methylsulfate is a specific PCP antagonist and site-directed acylating agent of the [3H]phencyclidine binding site in rat brain homogenates. Metaphit methylsulfate prevents PCP-induced locomotor behavior through presynaptic mechanisms.
    Metaphit methylsulfate
  • HY-168771
    gamma-DGG TFA
    		Antagonist
    gamma-DGG TFA is the antagonist for excitatory amino acid, that blocks NMDA-(HY-17551), Kainate-(HY-N2309) and Quisqualate-(HY-12597) induced depolarization, and antagonises the excitatory postsynaptic potential (e.p.s.p.) in rat hippocampal slices.
    gamma-DGG TFA
  • HY-138973
    Neramexane
    		Antagonist
    Neramexane is an oral N-methyl-D-aspartate (NMDA) receptor antagonist, as a potential neuroprotectant for various central nervous system disorders, including Alzheimer's disease, and for the potential treatment of drug and alcohol dependence, and pain.
    Neramexane
  • HY-107605
    UBP296
    		Antagonist
    UBP296 is a potent and selective antagonist of GLUK5-containing kainate receptor in the spinal cord. UBP296 reversibly blocks ATPA-induced depressions of synaptic transmission, and affects AMPA receptor-mediated synaptic transmission directly in rat hippocampal slices.
    UBP296
  • HY-P3431
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
    		Antagonist
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
  • HY-N1593
    15-Methoxypinusolidic acid
    15-Methoxypinusolidic acid (compound 1) is a labdane diterpene compound isolated from the leaves of Calocedrus microlepic.
    15-Methoxypinusolidic acid
  • HY-P3431A
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
    		Antagonist
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
Cat. No. Product Name / Synonyms Application Reactivity
iGluR Isoform Comparison

Your Search Returned No Results.

Sorry. There is currently no product that acts on isoform together.

Please try each isoform separately.