1. PI3K/Akt/mTOR Stem Cell/Wnt MAPK/ERK Pathway TGF-beta/Smad
  2. Akt Gli JNK PKA
  3. Adropin (34-76) (human, mouse, rat)

Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Adropin (34-76) (human, mouse, rat) Chemical Structure

Adropin (34-76) (human, mouse, rat) Chemical Structure

CAS No. : 1802086-30-1

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products

View All Akt Isoform Specific Products:

View All JNK Isoform Specific Products:

View All PKA Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway[1][2].

In Vitro

Adropin (34-76) (100 nM; 3 h) inhibits glucose production in primary cultured mouse hepatocytes[1].
Adropin (34-76) (100 nM; 3 h) decreases cAMP levels in HepG2 hepatocytes[1].
Adropin (34-76) (0-100 ng/mL; 48 h) inhibits TGF-β-induced cell activation, collagen production and fibrotic remodeling in fibroblasts[2].
Adropin (34-76) (100 ng/mL; 48 h) plays an anti-fibrotic role in fibroblasts by inhibiting the GLI1 signaling pathway[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Western Blot Analysis [2]

Cell Line: TGF-β treated fibroblasts
Concentration: 0, 10, 50 and 100 ng/mL
Incubation Time: 48 h
Result: Reduced the levels of α-smooth muscle actin and type І collagen in a dose-dependent manner.

Immunofluorescence [2]

Cell Line: TGF-β treated fibroblasts
Concentration: 100 ng/mL
Incubation Time: 48 h
Result: Reduced GLI1 and GLI2 staining intensity but did not interfere with the nuclear translocation of GLI1 or GLI2.
In Vivo

Adropin (34-76) (450 nmol/kg ≈ 2 mg/kg; intraperitoneal injection; 5 injections within 48 hours) has a hypoglycemic effect in a diet-induced obesity model of mice[1].
Adropin (34-76) (10 μg/kg/h; subcutaneous osmotic pump; 25 days) has an improved effect in the mouse model of fibrosis[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Male DIO B6 mice[1]
Dosage: 450 nmol/kg ≈ 2 mg/kg
Administration: Five intraperitoneal injections over a 48-h period
Result: Enhanced intracellular signaling actions underlying insulin’s effect on hepatic glucose metabolism.
Alleviated hepatic ER stress responses.
Diminished JNK and PKA signaling in the liver.
Down-regulates hepatic lipogenic genes.
Altered the phosphorylation levels of IP3R in the liver.
Animal Model: Mouse with fibrosis model[2]
Dosage: 10 μg/kg/h
Administration: Subcutaneous osmotic pump; 25 days
Result: Ameliorated allogeneic bone marrow transplantation (alloBMT)-induced skin fibrosis, with reduced dermal thickness, lower myofibroblast counts, and decreased hydroxyproline content.
Ameliorated alloBMT-induced pulmonary fibrosis, with reduced Ashcroft scores and hydroxyproline content.
Molecular Weight

4499.82

Formula

C190H293N55O68S2

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro (Disulfide bridge: Cys1-Cys23)

Sequence Shortening

CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP (Disulfide bridge: Cys1-Cys23)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

DMSO : 50 mg/mL (11.11 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2222 mL 1.1112 mL 2.2223 mL
5 mM 0.0444 mL 0.2222 mL 0.4445 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2222 mL 1.1112 mL 2.2223 mL 5.5558 mL
5 mM 0.0444 mL 0.2222 mL 0.4445 mL 1.1112 mL
10 mM 0.0222 mL 0.1111 mL 0.2222 mL 0.5556 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adropin (34-76) (human, mouse, rat)
Cat. No.:
HY-P4860
Quantity:
MCE Japan Authorized Agent: