Adropin (34-76) (human, mouse, rat)

Name: Adropin (34-76) (human, mouse, rat)
Brand: MedChemExpress
SKU: HY-P4860
Rating: 4.5 (1 reviews)

Cat. No.: HY-P4860 Purity: 99.87%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Adropin (34-76) (human, mouse, rat) Chemical Structure

CAS No. : 1802086-30-1

Size	Stock	Quantity
1 mg	In-stock	Estimated Time of Arrival: December 31
5 mg	In-stock	Estimated Time of Arrival: December 31
10 mg	In-stock	Estimated Time of Arrival: December 31
50 mg	Get quote
100 mg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

View All Akt Isoform Specific Products:

View All Isoforms

Akt Akt1 Akt2 Akt3

View All JNK Isoform Specific Products:

View All Isoforms

JNK1 JNK2 JNK3 JNK

View All PKA Isoform Specific Products:

View All Isoforms

PKA PKAR

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vitro

Adropin (34-76) (100 nM; 3 h) inhibits glucose production in primary cultured mouse hepatocytes^[1].
Adropin (34-76) (100 nM; 3 h) decreases cAMP levels in HepG2 hepatocytes^[1].
Adropin (34-76) (0-100 ng/mL; 48 h) inhibits TGF-β-induced cell activation, collagen production and fibrotic remodeling in fibroblasts^[2].
Adropin (34-76) (100 ng/mL; 48 h) plays an anti-fibrotic role in fibroblasts by inhibiting the GLI1 signaling pathway^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Western Blot Analysis ^[2]

Cell Line:	TGF-β treated fibroblasts
Concentration:	0, 10, 50 and 100 ng/mL
Incubation Time:	48 h
Result:	Reduced the levels of α-smooth muscle actin and type І collagen in a dose-dependent manner.

Immunofluorescence ^[2]

Cell Line:	TGF-β treated fibroblasts
Concentration:	100 ng/mL
Incubation Time:	48 h
Result:	Reduced GLI1 and GLI2 staining intensity but did not interfere with the nuclear translocation of GLI1 or GLI2.

In Vivo

Adropin (34-76) (450 nmol/kg ≈ 2 mg/kg; intraperitoneal injection; 5 injections within 48 hours) has a hypoglycemic effect in a diet-induced obesity model of mice^[1].
Adropin (34-76) (10 μg/kg/h; subcutaneous osmotic pump; 25 days) has an improved effect in the mouse model of fibrosis^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Male DIO B6 mice^[1]
Dosage:	450 nmol/kg ≈ 2 mg/kg
Administration:	Five intraperitoneal injections over a 48-h period
Result:	Enhanced intracellular signaling actions underlying insulin’s effect on hepatic glucose metabolism. Alleviated hepatic ER stress responses. Diminished JNK and PKA signaling in the liver. Down-regulates hepatic lipogenic genes. Altered the phosphorylation levels of IP3R in the liver.

Animal Model:	Mouse with fibrosis model^[2]
Dosage:	10 μg/kg/h
Administration:	Subcutaneous osmotic pump; 25 days
Result:	Ameliorated allogeneic bone marrow transplantation (alloBMT)-induced skin fibrosis, with reduced dermal thickness, lower myofibroblast counts, and decreased hydroxyproline content. Ameliorated alloBMT-induced pulmonary fibrosis, with reduced Ashcroft scores and hydroxyproline content.

Molecular Weight

4499.82

Formula

C₁₉₀H₂₉₃N₅₅O₆₈S₂

CAS No.

1802086-30-1

Appearance

Solid

Color

White to off-white

Sequence

Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro (Disulfide bridge: Cys1-Cys23)

Sequence Shortening

CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP (Disulfide bridge: Cys1-Cys23)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility

In Vitro:

DMSO : 50 mg/mL (11.11 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2222 mL	1.1112 mL	2.2223 mL
5 mM	0.0444 mL	0.2222 mL	0.4445 mL
10 mM	0.0222 mL	0.1111 mL	0.2222 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

Purity & Documentation

Purity: 99.87%

Select Batch:

Data Sheet (275 KB) SDS (252 KB)

COA (242 KB) LCMS (91 KB) Elemental Analysis Report (100 KB)

Handling Instructions (2659 KB)

References

[1]. Gao S, et al. The peptide hormone adropin regulates signal transduction pathways controlling hepatic glucose metabolism in a mouse model of diet-induced obesity. J Biol Chem. 2019 Sep 6;294(36):13366-13377. [Content Brief]

[2]. Liang M, et al. Attenuation of fibroblast activation and fibrosis by adropin in systemic sclerosis. Sci Transl Med. 2024 Mar 27;16(740):eadd6570. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

DMSO	1 mM	0.2222 mL	1.1112 mL	2.2223 mL	5.5558 mL
	5 mM	0.0444 mL	0.2222 mL	0.4445 mL	1.1112 mL
	10 mM	0.0222 mL	0.1111 mL	0.2222 mL	0.5556 mL