1. Cell Cycle/DNA Damage
  2. DNA/RNA Synthesis RAD51
  3. BRC4 peptide

BRC4 peptide is a specific peptide in BRCA2 protein that interacts with RAD51 protein to help repair broken DNA chains. BRC4 peptide can be used to study DNA repair mechanisms and cancer occurrence.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

BRC4 peptide Chemical Structure

BRC4 peptide Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

BRC4 peptide is a specific peptide in BRCA2 protein that interacts with RAD51 protein to help repair broken DNA chains. BRC4 peptide can be used to study DNA repair mechanisms and cancer occurrence[1].

Molecular Weight

3956.54

Formula

C178H296N48O53

Sequence

Lys-Glu-Pro-Thr-Leu-Leu-Gly-Phe-His-Thr-Ala-Ser-Gly-Lys-Lys-Val-Lys-Ile-Ala-Lys-Glu-Ser-Leu-Asp-Lys-Val-Lys-Asn-Leu-Phe-Asp-Glu-Lys-Glu-Gln-NH2

Sequence Shortening

KEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BRC4 peptide
Cat. No.:
HY-P10516
Quantity:
MCE Japan Authorized Agent: