2. GPCR/G Protein
  3. GCGR
  4. Cotadutide

Cotadutide  (Synonyms: MEDI0382)

Cat. No.: HY-P2231 Purity: 98.88%
SDS COA Handling Instructions

Molarity Calculator

Cotadutide (MEDI0382) is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide exhibits ability to facilitate both weight loss and glycaemic control, and alleviate fibrosis. Cotadutide can be used in the research of obesity and type 2 diabetes (T2D).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Cotadutide Chemical Structure

Cotadutide Chemical Structure

CAS No. : 1686108-82-6

Size Price Stock Quantity
5 mg USD 560 In-stock
10 mg USD 900 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Cotadutide:

Cotadutide Related Antibodies

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Cotadutide

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Cotadutide (MEDI0382) is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide exhibits ability to facilitate both weight loss and glycaemic control, and alleviate fibrosis. Cotadutide can be used in the research of obesity and type 2 diabetes (T2D)[1][2][3].

IC50 & Target

EC50: 6.9 pM (GLP-1); 10.2 pM (GCGR)[1]
In Vitro

Cotadutide stimulates a concentration-dependent increase in cAMP accumulation in rat (INS-1 832/3) and human (EndoC-βH1) β-cell lines (EC50: 226 pM and 1051 pM, respectively?), as well as rat, mouse and human hepatocytes (EC50: 462 pM, 840 pM, 1447 pM, respectively)[1].
Cotadutide (100 pM-1 μM) potentiates glucose-stimulated insulin secretion in the rat (INS-1 832/3) pancreatic β‐cell line and increases glucose output in rat hepatocytes[1].
Cotadutide (100 nM, 2 h) induces mitochondrial turnover and enhances mitochondrial function in mouse primary hepatocytes[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cotadutide Related Antibodies
In Vivo

Cotadutide (10?nmol/kg, s.c., once) suppresses food intake in DIO mice relative to vehicle‐treated controls[1].
Cotadutide (10 or 30?nmol/kg, s.c., once daily for 14-16 weeks) reduces body weight in DIO mice[1].
Cotadutide (30 nmol/kg, s.c., once a day for 6 weeks) reduces hepatic fibrosis and inflammation in in ob/ob AMLN NASH mice[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Diet-induced obesity (DIO) mice[1]
Dosage: 10 nmol/kg
Administration: Subcutaneousinjection (s.c.)
Result: Showed a redction of food intake in mice after an acute administration.
Animal Model: Diet-induced obesity (DIO) mice[1]
Dosage: 10 or 30 nmol/kg
Administration: Subcutaneousinjection (s.c.)
Result: Reduced body weight and food intake, and improved glucose tolerance in DIO mice.
Clinical Trial
Molecular Weight

3728.09

Formula

C167H252N42O55
CAS No.
Appearance

Solid

Color

White to off-white

Sequence

1'-{palmtoyl-Glu}; His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Lys-Ser-Glu-Tyr-Leu-Asp-Ser-Glu-Arg-Ala-Arg-Asp-Phe-Val-Ala-Trp-Leu-Glu-Ala-Gly-Gly (Amide bridge: 1'-{palmtoyl-Glu}-Lys10)
Sequence Shortening

1'-{palmtoyl-Glu}; HSQGTFTSDKSEYLDSERARDFVAWLEAGG (Amide bridge: 1'-{palmtoyl-Glu}-Lys10)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (26.82 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2682 mL 1.3412 mL 2.6823 mL
5 mM 0.0536 mL 0.2682 mL 0.5365 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2682 mL 1.3412 mL 2.6823 mL 6.7058 mL
5 mM 0.0536 mL 0.2682 mL 0.5365 mL 1.3412 mL
10 mM 0.0268 mL 0.1341 mL 0.2682 mL 0.6706 mL
15 mM 0.0179 mL 0.0894 mL 0.1788 mL 0.4471 mL
20 mM 0.0134 mL 0.0671 mL 0.1341 mL 0.3353 mL
25 mM 0.0107 mL 0.0536 mL 0.1073 mL 0.2682 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Cotadutide Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Cotadutide1686108-82-6MEDI0382MEDI 0382MEDI-0382GCGRGlucagon ReceptorFOODuptakediabeteT2DobesityNASHfibrosisinflammationInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cotadutide
Cat. No.:
HY-P2231
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.