Endothelin-1 (1-31) (Human)

Cat. No.: HY-P4159: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) is derived from the selective hydrolysis of big ET-1 by chymase.

For research use only. We do not sell to patients.

Endothelin-1 (1-31) (Human) Chemical Structure

CAS No. : 133972-52-8

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Endothelin-1 (1-31) (Human):

Endothelin-1 (1-31) (Human) TFA Get quote
Endothelin-1 (1-31) (Human) acetate Get quote

1 Publications Citing Use of MCE Endothelin-1 (1-31) (Human)

•Acta Pharmacol Sin. 2024 Mar;45(3):545-557. [Abstract]

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All ERK Isoform Specific Products:

View All Isoforms

ERK ERK1 ERK2 ERK5 ERK8

Biological Activity
Purity & Documentation
References
Customer Review

Description

Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) is derived from the selective hydrolysis of big ET-1 by chymase^[1].

In Vitro

Endothelin-1 (1-31) (Human) (100 pM-100 nM; 24 h) induces human mesangial cells proliferation^[2].
Endothelin-1 (1-31) (Human) (100 nM; 0-10 min) induces ERK activation in human mesangial cells^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Proliferation Assay^[2]

Cell Line:	Human mesangial cells
Concentration:	100 pM-100 nM
Incubation Time:	24 h
Result:	Caused an increase in [³H]-thymidine incorporation into the cells in a concentration-dependent manner.

Western Blot Analysis^[2]

Cell Line:	Human mesangial cells
Concentration:	100 nM
Incubation Time:	0, 5, 10, 15 and 30 min
Result:	ERK activities rapidly increased 2.45-fold at 5 min and peaked at 10 min. The activities of both ERKs rapidly declined, returning to the baseline control value 30 min after stimulation.

In Vivo

ET-1 (1-31) (100 nM; single dose) induces contraction in the mouse mesenteric artery. The contraction may be mediated by the ET_A receptor and may be increased by aging. A clear difference exists between males and females in the present chronic diabetic condition^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	ICR mice, Streptozocin (HY-13753)-induced diabetic model^[1]
Dosage:	100 nM
Administration:	In the organ bath, single dose
Result:	In the 1-week control (but not diabetic) group, induced contraction and the contractile response was significantly greater in female mice than in male mice, and there was no significant difference in either male or female mice between the age-matched controls and the diabetic mice. In the 8-weeks group, the contraction was or tended to be increased compared with the corresponding 1-week group in all mice. Although in male mice this contraction was not different between control and diabetic groups, it was significantly greater in diabetic female mice than in the control female mice and in female diabetic mice than in male diabetic mice. The contraction was inhibited by ET_A receptor inhibitor.

Molecular Weight

3628.16

Formula

C₁₆₂H₂₃₆N₃₈O₄₇S₅

CAS No.

133972-52-8

Sequence

Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr (Disulfide bridge:Cys1-Cys15;Cys3-Cys11)

Sequence Shortening

CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY (Disulfide bridge:Cys1-Cys15;Cys3-Cys11)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Solvent & Solubility

In Vitro:

H₂O

Peptide Solubility and Storage Guidelines:

1. Calculate the length of the peptide.

2. Calculate the overall charge of the entire peptide according to the following table:

	Contents	Assign value
Acidic amino acid	Asp (D), Glu (E), and the C-terminal -COOH.	-1
Basic amino acid	Arg (R), Lys (K), His (H), and the N-terminal -NH₂	+1
Neutral amino acid	Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q)	0

3. Recommended solution:

Overall charge of peptide	Details
Negative (<0)	1. Try to dissolve the peptide in water first. 2. If water fails, add NH₄OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0)	1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0)	1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.

Purity & Documentation

Handling Instructions (2659 KB)

References

[1]. Matsumoto T, et al. Gender differences in vascular reactivity to endothelin-1 (1-31) in mesenteric arteries from diabetic mice. Peptides. 2008 Aug;29(8):1338-46. [Content Brief]

[2]. Yoshizumi M, et al. Effect of endothelin-1 (1-31) on human mesangial cell proliferation. Jpn J Pharmacol. 2000 Oct;84(2):146-55. [Content Brief]