Fasciculin-I (Synonyms: FAS-I)

Cat. No.: HY-P5798: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Fasciculin-I is isolated from the mambas venom. Fasciculin-I exerts its toxic effects by inhibiting acetylcholinesterase (AChE). Fasciculin-I blocks α-neurotoxins of nicotinic acetylcholine receptors and cardiac toxins that interact with cell membranes .

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Fasciculin-I Chemical Structure

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Cholinesterase (ChE) Isoform Specific Products:

View All Isoforms

AChE BChE

Biological Activity
Purity & Documentation
References
Customer Review

Description	Fasciculin-I is isolated from the mambas venom. Fasciculin-I exerts its toxic effects by inhibiting acetylcholinesterase (AChE). Fasciculin-I blocks α-neurotoxins of nicotinic acetylcholine receptors and cardiac toxins that interact with cell membranes ^[1].
Molecular Weight	6798.69
Formula	C₂₈₁H₄₄₁N₈₇O₉₀S₁₀
Sequence	Thr-Met-Cys-Tyr-Ser-His-Thr-Thr-Thr-Ser-Arg-Ala-Ile-Leu-Thr-Asn-Cys-Gly-Glu-Asn-Ser-Cys-Tyr-Arg-Lys-Ser-Arg-Arg-His-Pro-Pro-Lys-Met-Val-Leu-Gly-Arg-Gly-Cys-Gly-Cys-Pro-Pro-Gly-Asp-Asp-Tyr-Leu-Glu-Val-Lys-Cys-Cys-Thr-Ser-Pro-Asp-Lys-Cys-Asn-Tyr (Disulfide bridge:Cys3-Cys22;Cys17-Cys39;Cys41-Cys52;Cys53-Cys59)
Sequence Shortening	TMCYSHTTTSRAILTNCGENSCYRKSRRHPPKMVLGRGCGCPPGDDYLEVKCCTSPDKCNY (Disulfide bridge:Cys3-Cys22;Cys17-Cys39;Cys41-Cys52;Cys53-Cys59)
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (259 KB) Handling Instructions (2659 KB)
References	[1]. van den Born HK, et al. Theoretical analysis of the structure of the peptide fasciculin and its docking to acetylcholinesterase. Protein Sci. 1995 Apr;4(4):703-15. [Content Brief]

Fasciculin-I Related Classifications

Neurological Disease

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Fasciculin-IFAS-ICholinesterase (ChE)acetylcholinesteraseelapid peptidessnake toxinsInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name

Lot #

Applicant Name *

Email Address *

Phone Number

Department *

Organization Name *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

Fasciculin-I (Synonyms: FAS-I)

Fasciculin-I Related Antibodies

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Cholinesterase (ChE) Isoform Specific Products:

Biological Activity

Purity & Documentation

References

Customer Review