1. Apoptosis
  2. MDM-2/p53 Apoptosis
  3. FOXO4-DRI

FOXO4-DRI is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI is a senolytic peptide that induces apoptosis of senescent cells.

For research use only. We do not sell to patients.

FOXO4-DRI Chemical Structure

FOXO4-DRI Chemical Structure

CAS No. : 2460055-10-9

Size Price Stock Quantity
1 mg USD 170 In-stock
5 mg USD 420 In-stock
10 mg USD 680 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of FOXO4-DRI:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

FOXO4-DRI is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI is a senolytic peptide that induces apoptosis of senescent cells[1].

In Vitro

FOXO4-DRI (25 mM; 3 days) causes nuclear exclusion of active p53 and induces apoptosis in senescent TM3 Leydig cells[1].
FOXO4-DRI (25 μM; 5 days) significantly reduces the senescence level in PDL9 cells[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Viability Assay[1]

Cell Line: Senescent Leydig cells
Concentration: 25 mM
Incubation Time: 3 days
Result: Reduced the viability of senescent as compared to normal TM3 Leydig cells.

Apoptosis Analysis[1]

Cell Line: Senescent Leydig cells
Concentration: 25 mM
Incubation Time: 3 days
Result: The apoptosis rate increased from 10% to 27%.

Western Blot Analysis[2]

Cell Line: PDL9 cells
Concentration: 25 μM
Incubation Time: 5 days
Result: Decreased the protein levels of representative senescent markers, including p16, p21, and p53.

RT-PCR[2]

Cell Line: PDL9 cells
Concentration: 25 μM
Incubation Time: 5 days
Result: Enhanced SOX9 expression, and reduced MMP12 and MMP13 expression.
In Vivo

FOXO4-DRI (5 mg/kg; i.p.; every other day for three administrations) alleviates testosterone secretion insufficiency and improves the testicular microenvironment in naturally aged mice[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Naturally aged male C57BL/6 mice (20-24 months old)[1]
Dosage: 5 mg/kg
Administration: Intraperitoneal injection, every other day for three administrations
Result: Increased serum testosterone levels. Increased levels of both 3β-HSD and CYP11A1. Decreased interstitial SA-β-gal activity and lowered levels of senescence-associated proteins p53, p21, and p16. Decreased the levels of IL-1β, IL-6 and TGF-β.
Molecular Weight

5358.06

Formula

C228H388N86O64

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

D-(Leu-Thr-Leu-Arg-Lys-Glu-Pro-Ala-Ser-Glu-Ile-Ala-Gln-Ser-Ile-Leu-Glu-Ala-Tyr-Ser-Gln-Asn-Gly-Trp-Ala-Asn-Arg-Arg-Ser-Gly-Gly-Lys-Arg-Pro-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly)

Sequence Shortening

D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)

SMILES

O=C(N[C@H]([C@@H](O)C)C(N[C@H](CC(C)C)C(N[C@H](CCCNC(N)=N)C(N[C@H](CCCCN)C(N[C@H](CCC(O)=O)C(N1[C@H](CCC1)C(N[C@H](C)C(N[C@H](CO)C(N[C@H](CCC(O)=O)C(N[C@H]([C@H](C)CC)C(N[C@H](C)C(N[C@H](CCC(N)=O)C(N[C@H](CO)C(N[C@H]([C@H](C)CC)C(N[C@H](CC(C)C)C(N[C@H](CCC(O)=O)C(N[C@H](C)C(N[C@H](CC2=CC=C(C=C2)O)C(N[C@H](CO)C(N[C@H](CCC(N)=O)C(N[C@H](CC(N)=O)C(NCC(N[C@H](CC3=CNC4=CC=CC=C34)C(N[C@H](C)C(N[C@H](CC(N)=O)C(N[C@H](CCCNC(N)=N)C(N[C@H](CCCNC(N)=N)C(N[C@H](CO)C(NCC(NCC(N[C@H](CCCCN)C(N[C@H](CCCNC(N)=N)C(N5[C@H](CCC5)C(N6[C@H](CCC6)C(N7[C@H](CCC7)C(N[C@H](CCCNC(N)=N)C(N[C@H](CCCNC(N)=N)C(N[C@H](CCCNC(N)=N)C(N[C@H](CCC(N)=O)C(N[C@H](CCCNC(N)=N)C(N[C@H](CCCNC(N)=N)C(N[C@H](CCCCN)C(N[C@H](CCCCN)C(N[C@H](CCCNC(N)=N)C(NCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@@H](CC(C)C)N

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : 100 mg/mL (18.66 mM; Need ultrasonic)

DMSO : 50 mg/mL (9.33 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.1866 mL 0.9332 mL 1.8663 mL
5 mM 0.0373 mL 0.1866 mL 0.3733 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO / H2O 1 mM 0.1866 mL 0.9332 mL 1.8663 mL 4.6659 mL
5 mM 0.0373 mL 0.1866 mL 0.3733 mL 0.9332 mL
H2O 10 mM 0.0187 mL 0.0933 mL 0.1866 mL 0.4666 mL
15 mM 0.0124 mL 0.0622 mL 0.1244 mL 0.3111 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FOXO4-DRI
Cat. No.:
HY-P4157
Quantity:
MCE Japan Authorized Agent: