Mecasermin  (Synonyms: Human IGF-I; FK 780)

Mecasermin (Human IGF-I; FK 780) is a recombinant human insulin-like growth factor I (IGF-I). Mecasermin has the potential for the study of the growth failure of growth hormone (GH) insensitivity caused by GH receptor defects or GH-inhibiting antibodies^[1].

Mecasermin (rhIGF1; 0.25 mg/kg; i.p.; daily; 6 weeks) increases IGF1 concentration in serum to near-normal levels and ameliorates a wide range of phenotypes, including organismal and behavioral function, synaptic and circuit plasticity, neuronal structure, and molecular signaling pathways^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

7645.68

C₃₃₁H₅₁₂N₉₄O₁₀₁S₇

68562-41-4

Gly-Pro-Glu-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-Ala-Lys-Ser-Ala (Disulfide bridge:Cys6-Cys48;Cys18-Cys61;Cys47-Cys52)

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (Disulfide bridge:Cys6-Cys48;Cys18-Cys61;Cys47-Cys52)

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Arlan L Rosenbloom. Mecasermin (recombinant human insulin-like growth factor I). Adv Ther. 2009 Jan;26(1):40-54.  [Content Brief]

  [2]. Jorge Castro, et al. Functional recovery with recombinant human IGF1 treatment in a mouse model of Rett Syndrome. Proc Natl Acad Sci U S A. 2014 Jul 8;111(27):9941-6.  [Content Brief]