2. Peptides
  3. Peptide and Derivatives
  4. Inhibitors and Substrates
  5. Nisotirostide

Nisotirostide  (Synonyms: LY-3457263)

Cat. No.: HY-P10026 Purity: 99.45%
SDS COA Handling Instructions

Molarity Calculator

Nisotirotide (LY-3457263) is a PYY analog agonist studied in type 2 diabetes and obesity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Nisotirostide Chemical Structure

Nisotirostide Chemical Structure

CAS No. : 2663844-45-7

Size Price Stock Quantity
5 mg USD 250 In-stock
10 mg USD 400 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Nisotirostide Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Nisotirotide (LY-3457263) is a PYY analog agonist studied in type 2 diabetes and obesity[1].

Molecular Weight

4974.53

Formula

C230H343N59O65
CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Chain1:Pro-Lys-Pro-Glu-Lys-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Trp-Gln-Arg-Tyr-Tyr-Ala-Glu-Leu-Arg-His-Tyr-Leu-Asn-Trp-Leu-Thr-Arg-Gln-Arg-Tyr-NH2; Chain2:Ggu-Ggu-Oaa (Amide bridge:Chain1 Lys5-Chain2 Oaa3)
Sequence Shortening

Chain1:PKPEKPGEDASPEEWQRYYAELRHYLNWLTRQRY-NH2; Chain2:Ggu-Ggu-Oaa (Amide bridge:Chain1 Lys5-Chain2 Oaa3)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 125 mg/mL (25.13 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2010 mL 1.0051 mL 2.0102 mL
5 mM 0.0402 mL 0.2010 mL 0.4020 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2010 mL 1.0051 mL 2.0102 mL 5.0256 mL
5 mM 0.0402 mL 0.2010 mL 0.4020 mL 1.0051 mL
10 mM 0.0201 mL 0.1005 mL 0.2010 mL 0.5026 mL
15 mM 0.0134 mL 0.0670 mL 0.1340 mL 0.3350 mL
20 mM 0.0101 mL 0.0503 mL 0.1005 mL 0.2513 mL
25 mM 0.0080 mL 0.0402 mL 0.0804 mL 0.2010 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Nisotirostide Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Nisotirostide2663844-45-7LY-3457263LY3457263LY 3457263OthersPYY analog agonistInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nisotirostide
Cat. No.:
HY-P10026
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.