ABHD14B Protein, Human (His)

ABHD14B Protein, identified as an atypical protein-lysine deacetylase, catalyzes lysine deacetylation using CoA as a substrate in vitro, generating acetyl-CoA and free amine. Although confirmation of in vivo deacetylase activity is needed, ABHD14B also exhibits hydrolase activity toward various p-nitrophenyl substrates. It may potentially activate transcription. ABHD14B Protein, Human (His) is the recombinant human-derived ABHD14B protein, expressed by E. coli , with N-6*His labeled tag. The total length of ABHD14B Protein, Human (His) is 210 a.a., with molecular weight of ~24 KDa.

ABHD14B exhibits atypical protein-lysine deacetylase activity in vitro, facilitating the deacetylation of lysine residues using CoA as a substrate and generating acetyl-CoA along with the free amine of protein-lysine residues. While further experiments are needed to validate its protein-lysine deacetylase activity in vivo, the enzyme also demonstrates hydrolase activity towards various surrogate p-nitrophenyl (pNp) substrates, with a pronounced preference for pNp-acetate. Additionally, ABHD14B may play a role in transcriptional activation, highlighting its potential involvement in cellular processes related to acetylation and hydrolysis.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

Q96IU4-1 (M1-Q210)

84836  [NCBI]

MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ

Approximately 24 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of sterile 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.