ACLY Protein, Human (His-SUMO)

ACLY Protein, Human (His-SUMO) is an important enzyme in the cholesterol biosynthetic pathway. ACLY produces acetyl-CoA (AcCoA) from mitochondrial citrate for cholesterol and fatty acid biosynthesis.

ATP citrate lyase (ACLY) is an important enzyme linking carbohydrate to lipid metabolism by generating acetyl-CoA from citrate for fatty acid and cholesterol biosynthesis. ACLY is an important enzyme in the cholesterol biosynthetic pathway upstream of the 3-hydroxy3-methylglutaryl coenzyme A reductase (HMGCR) (which is targeted by statins). ACLY produces acetyl-CoA (AcCoA) from mitochondrial citrate for cholesterol and fatty acid biosynthesis. ACLY forms homotetramers through the C-terminus (citrate synthase homeodomain) to promote ACLY binding to CoA and AcCoA production^[1].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His;N-SUMO

P53396 (K4-K265)

47  [NCBI]

KAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLK

Approximately 45.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.