1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. ANG-1
  5. Angiopoietin-1 Protein, Human (HEK293, Fc)

Angiopoietin-1 Protein, Human (HEK 293, Fc) is a secreted protein located on the outside of cell membranes and is an agonistic ligand of receptor tyrosine kinase that is mainly expressed by vascular endothelial cells and hematopoietic cells. Angiopoietin-1 Protein, Human (HEK 293, Fc) is a potent inducer of sprouting angiogenesis, proming for research of colorectal cancer liver metastases (CRCLMs). Angiopoietin-1 Protein, Human (HEK 293, Fc) induces vascular remodeling through highly organized angiogenesis and tightening of endothelial cell (EC) junctions. Angiopoietin-1 Protein, Human (HEK 293, Fc) regulates angiogenesis, endothelial cell survival, proliferation, migration, adhesion and maintenance of vascular quiescence. Angiopoietin-1 Protein, Human (HEK 293, Fc) is a recombinant protein with a Fc label that consisting of 498 amino acids and is expressed in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Angiopoietin-1 Protein, Human (HEK 293, Fc) is a secreted protein located on the outside of cell membranes and is an agonistic ligand of receptor tyrosine kinase that is mainly expressed by vascular endothelial cells and hematopoietic cells. Angiopoietin-1 Protein, Human (HEK 293, Fc) is a potent inducer of sprouting angiogenesis, proming for research of colorectal cancer liver metastases (CRCLMs). Angiopoietin-1 Protein, Human (HEK 293, Fc) induces vascular remodeling through highly organized angiogenesis and tightening of endothelial cell (EC) junctions. Angiopoietin-1 Protein, Human (HEK 293, Fc) regulates angiogenesis, endothelial cell survival, proliferation, migration, adhesion and maintenance of vascular quiescence. Angiopoietin-1 Protein, Human (HEK 293, Fc) is a recombinant protein with a Fc label that consisting of 498 amino acids and is expressed in HEK293 cells[1][2][3][4][5][6][7].

Background

Angiopoietin-1 Protein, Human (HEK 293, Fc) is a secreted protein ligand for ‘tunica interna endothelial cell kinase’, Tek (Tie2), which is primarily expressed in growing vascular ECs and a subset of hematopoietic cells[1].
Angiopoietin-1 Protein, Human (HEK 293, Fc) induces distinct angiogenesis through both vascular Tie2 and integrin signaling and nonvascular integrin signaling. Angiopoietin-1 Protein is a potential growth factor for therapeutic angiogenesis and vascular stabilization[1].
Angiopoietin-1 Protein, Human (HEK 293, Fc) contains a carboxyl-terminal fibrinogen-like domain that binds to the Tie2 receptor, a central coiled-coil domain that enables oligomerization of these fibrinogen-like domains and a short amino-terminal domain that superclusters the oligomers into variably sizedmultimers[2].
Angiopoietin-1 Protein, Human (HEK 293, Fc) (0.5-10 nM) induces the formation of capillary sprouts in a dose-dependent manner that is completely inhibited by soluble Tie2 receptor extracellular domains in human umbilical vein endothelial cells[4].
Both the human and mouse Angiopoietin-1 cDNA clones reveals open reading frames encoding 498 amino acids and sharing 97.6% identity[5].
Angiopoietin-1 Protein, Human (HEK 293, Fc) promotes TKI-resistance via activation of JAK/STAT5 pathway in chronic myeloid leukemia[7].

In Vitro

Angiopoietin-1 Protein, Human (HEK 293, Fc) (220 ng/mL) induces the formation of capillary sprouts synergied with VEGF (1 ng/mL) in a dose-dependent manner that is completely inhibited by soluble Tie2 receptor extracellular domains in human umbilical vein endothelial cells[4].
Angiopoietin-1 Protein, Human (HEK 293, Fc) (0-74 ng/mL, 3 days) possesses only very weak mitogenic activity for human umbilical vein endothelial cells[4].
Angiopoietin-1 Protein, Human (HEK 293, Fc) induces tyrosine phosphorylation of TIE2 in human endothelial cell types (HUCEC, HAEC, HMVEC and HUVEC) and this induction is blocked by the addition of excess soluble TIE2-Fc but not TrkB-Fc[5].
Angiopoietin-1 Protein, Human (HEK 293, Fc) (0.2 μM, 24 h) acts as a positive regulator of ARP2/3 expression through Tie2-PI3K/AKT pathway in MC38, SW620 and COLO320DM cancer cells[6].

In Vivo

Overexpression of Angiopoietin-1 Protein, Human (HEK 293, Fc) results in a dramatic increase in the number, size and branching pattern of blood vessels in mice[3].
Transgenic mice overexpressing Angiopoietin-1 Protein, Human (HEK 293, Fc) has many more large blood vessels in the skin of newborn mice and becomes markedly redder than normal in the skin of older mice[3].

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of HUVEC human umbilical vein endothelial cells. The ED50 for this effect is ≤356.9 ng/ml, corresponding to a specific activity is ≥2801.905 units/mg.

  • Measured by the ability of the immobilized protein to support the adhesion of HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 356.9 ng/ml, corresponding to a specific activity is 2801.905 units/mg.
Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q15389 (D256-F498)

Gene ID

284  [NCBI]

Molecular Construction
N-term
hFc
Angiopoietin-1 (D256-F498)
Accession # Q15389
C-term
Synonyms
rHuAngiopoietin-1/ANG1, Fc; AGP1; AGPT; Ang1; ANG-1; angiopoietin 1; Angiopoietin-1; ANGPT1
AA Sequence

DTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF

Molecular Weight

Approximately 55-60 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Angiopoietin-1 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Angiopoietin-1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70061
Quantity:
MCE Japan Authorized Agent: