1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. Angiopoietin Like 3 Proteins
  5. ANGPTL3/Angiopoietin-like 3 Protein, Mouse (HEK293, His)

ANGPTL3/Angiopoietin-like 3 Protein, Mouse (HEK293, His)

Cat. No.: HY-P7504
SDS COA Handling Instructions Technical Support

ANGPTL3/Angiopoietin-like 3 Protein, Mouse (HEK293, His) is a mouse recombinant ANGPTL3 with a 10-His tag at the C-terminus. Angiopoietin-like Protein 3, Mouse (HEK293, His) is produced by Mammalian expression system and the target gene encoding Ser17-Thr455 is expressed.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

ANGPTL3/Angiopoietin-like 3 Protein, Mouse (HEK293, His) is a mouse recombinant ANGPTL3 with a 10-His tag at the C-terminus. Angiopoietin-like Protein 3, Mouse (HEK293, His) is produced by Mammalian expression system and the target gene encoding Ser17-Thr455 is expressed.

Background

ANGPTL3/Angiopoietin-like 3 Protein is a 70 kDa 460-amino acid long secretory glycoprotein primarily expressed in the liver. Mature mouse ANGPTL3 contains an N-terminal coiled-coil domain and a C-terminal fibrinogen-like domain. ANGPTL3 is implicated in angiogenesis and atherogenesis. ANGPTL3 can regulate serum lipid levels by acting on lipoprotein lipase- (LPL-) and endothelial lipase- (EL-) mediated triglyceride (TG) and phospholipid hydrolysis. Serum ANGPTL3 levels could serve as a biomarker for future occurrence of major adverse cardiovascular events (MACEs) with coronary artery disease (CAD). ANGPTL3 acts as proangiogenic and could induce angiogenesis in vivo via binding of the C-terminal fibrinogen-like domain to the integrin αvβ3 receptor on vascular endothelial cells[1].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9R182 (S17-T206)

Gene ID
Molecular Construction
N-term
ANGPTL3 (S17-T206)
Accession # Q9R182
6*His
C-term
Synonyms
rMuAngiopoietin-like Protein 3, His; ANGPTL3; Angiopoietin-like Protein 3
AA Sequence

SRVDPDLSSFDSAPSEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLRTNEIKEEEKELRRTTSTLQVKNEEVKNMSVELNSKLESLLEEKTALQHKVRALEEQLTNLILSPAGAQEHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHMQIKEIEKQLRKTHHHHHH

Molecular Weight

25-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

ANGPTL3/Angiopoietin-like 3 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANGPTL3/Angiopoietin-like 3 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7504
Quantity:
MCE Japan Authorized Agent: