ANGPTL3/Angiopoietin-like 3 Protein, Mouse (HEK293, His)

ANGPTL3/Angiopoietin-like 3 Protein, Mouse (HEK293, His) is a mouse recombinant ANGPTL3 with a 10-His tag at the C-terminus. Angiopoietin-like Protein 3, Mouse (HEK293, His) is produced by Mammalian expression system and the target gene encoding Ser17-Thr455 is expressed.

ANGPTL3/Angiopoietin-like 3 Protein is a 70 kDa 460-amino acid long secretory glycoprotein primarily expressed in the liver. Mature mouse ANGPTL3 contains an N-terminal coiled-coil domain and a C-terminal fibrinogen-like domain. ANGPTL3 is implicated in angiogenesis and atherogenesis. ANGPTL3 can regulate serum lipid levels by acting on lipoprotein lipase- (LPL-) and endothelial lipase- (EL-) mediated triglyceride (TG) and phospholipid hydrolysis. Serum ANGPTL3 levels could serve as a biomarker for future occurrence of major adverse cardiovascular events (MACEs) with coronary artery disease (CAD). ANGPTL3 acts as proangiogenic and could induce angiogenesis in vivo via binding of the C-terminal fibrinogen-like domain to the integrin αvβ3 receptor on vascular endothelial cells^[1].

Mouse

HEK293

C-6*His

Q9R182 (S17-T206)

30924  [NCBI]

SRVDPDLSSFDSAPSEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLRTNEIKEEEKELRRTTSTLQVKNEEVKNMSVELNSKLESLLEEKTALQHKVRALEEQLTNLILSPAGAQEHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHMQIKEIEKQLRKTHHHHHH

25-30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Chen MC, et al. High-Serum Angiopoietin-Like Protein 3 Levels Associated with Cardiovascular Outcome in Patients with Coronary Artery Disease. Int J Hypertens. 2020 Mar 27;2020:2980954.  [Content Brief]