1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. Angiopoietin-Like 7
  5. ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His)

ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His)

Cat. No.: HY-P7509
SDS COA Handling Instructions

ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His) regulates angiogenesis, and promotes the expansion and repopulation of human hematopoietic stem cells and progenitor cells through the Wnt signaling pathway. Angiopoietin-related Protein 7 is a pro-inflammatory effector that induces inflammatory responses in macrophages through the P38 MAPK signaling pathway.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $125 In-stock
50 μg $350 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His) regulates angiogenesis, and promotes the expansion and repopulation of human hematopoietic stem cells and progenitor cells through the Wnt signaling pathway. Angiopoietin-related Protein 7 is a pro-inflammatory effector that induces inflammatory responses in macrophages through the P38 MAPK signaling pathway.

Background

Human ANGPTL7/Angiopoietin-related 7 Protein is the least explored member of the Angptl family. It was originally cloned from human corneal cells and named corneaderived transcript 6. Angiopoietin-related Protein 7 can modify the expression of extracellular matrix proteins in human melanoma cells and trabecular meshwork cells, indicating that it functions as a corneal morphogen and can regulate intraocular pressure.

Species

Human

Source

HEK293

Tag

C-10*His

Accession

O43827 (Q27-P346)

Gene ID
Molecular Construction
N-term
ANGPTL7 (Q27-P346)
Accession # O43827
10*His
C-term
Synonyms
rHuAngiopoietin-related Protein 7, His; ANGPTL7; Angiopoietin-related Protein 7
AA Sequence

QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKPHHHHHHHHHH

Molecular Weight

35 kDa & (45-55) kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His)
Cat. No.:
HY-P7509
Quantity:
MCE Japan Authorized Agent: