ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His)

ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His) regulates angiogenesis, and promotes the expansion and repopulation of human hematopoietic stem cells and progenitor cells through the Wnt signaling pathway. Angiopoietin-related Protein 7 is a pro-inflammatory effector that induces inflammatory responses in macrophages through the P38 MAPK signaling pathway.

Human ANGPTL7/Angiopoietin-related 7 Protein is the least explored member of the Angptl family. It was originally cloned from human corneal cells and named corneaderived transcript 6. Angiopoietin-related Protein 7 can modify the expression of extracellular matrix proteins in human melanoma cells and trabecular meshwork cells, indicating that it functions as a corneal morphogen and can regulate intraocular pressure.

Human

HEK293

C-10*His

O43827 (Q27-P346)

10218  [NCBI]

QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKPHHHHHHHHHH

35 kDa & (45-55) kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Qian T, et al. Angiopoietin-Like Protein 7 Promotes an Inflammatory Phenotype in RAW264.7 Macrophages Through the P38 MAPK Signaling Pathway. Inflammation. 2016 Jun;39(3):974-85.  [Content Brief]