ANGPT2/Angiopoietin-2, Dog (HEK293, His)

ANGPT2/Angiopoietin-2 (dog) complexly regulates angiogenesis by binding to TEK/TIE2, competitively affecting ANGPT1 signaling. It independently induces TEK/TIE2 phosphorylation and, in the absence of VEGF, may cause endothelial cell apoptosis, thereby promoting vascular regression. ANGPT2/Angiopoietin-2, Dog (HEK293, His) is the recombinant dog-derived ANGPT2/Angiopoietin-2, Dog, expressed by HEK293 , with C-6*His labeled tag. The total length of ANGPT2/Angiopoietin-2, Dog (HEK293, His) is 477 a.a..

The Dog Angiopoietin-2 protein (ANGPT2) engages in a multifaceted role as it binds to TEK/TIE2, competing for the ANGPT1 binding site and effectively modulating ANGPT1 signaling. Notably, ANGPT2 has the capacity to induce tyrosine phosphorylation of TEK/TIE2 even in the absence of ANGPT1. Its function extends to angiogenesis regulation, where in the absence of angiogenic inducers like VEGF, ANGPT2-mediated loosening of cell-matrix contacts may lead to endothelial cell apoptosis, contributing to vascular regression. Conversely, in collaboration with VEGF, ANGPT2 can facilitate endothelial cell migration and proliferation, acting as a permissive angiogenic signal. Furthermore, ANGPT2 is implicated in the regulation of lymphangiogenesis. The protein's interactions with TEK/TIE2, competing for the same binding site as ANGPT1, and with ITGA5 underscore its comprehensive role in angiogenesis and vascular regulation within the context of dog biology.

Measured by its binding ability in a functional ELISA. Immobilized Dog Angiopoietin-2 at 10 μg/mL (100 μL/well) can bind human TIE-2. The ED₅₀ for this effect is 10-30 ng/mL.

Dog

HEK293

C-6*His

A0A8J8 (Y19-F495)

607616  [NCBI]

YNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHSLLTMISPSKSPKDTFVAKEEQIIYRDCAEVFKSGLTTNGIYTLTFPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVFQVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF

Approximately 60-85 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM MOPS, 150 mM NaCl, pH 7.4-7.5, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.