Animal-Free BCA-1/CXCL13 Protein, Human (His)

The BCA-1/CXCL13 protein selectively attracts B lymphocytes without affecting T lymphocytes, monocytes, or neutrophils. Unlike other chemokines, it does not induce calcium release from B lymphocytes. Animal-Free BCA-1/CXCL13 Protein, Human (His) is the recombinant human-derived animal-FreeBCA-1/CXCL13 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free BCA-1/CXCL13 Protein, Human (His) is 72 a.a., with molecular weight of ~9.49 kDa.

The BCA-1/CXCL13 protein acts as a selective chemotactic factor for B-lymphocytes, distinguishing its effects from T-lymphocytes, monocytes, and neutrophils. Unlike other chemokines, it does not induce calcium release in B-lymphocytes. Its specificity for B-lymphocytes is evidenced by its binding to BLR1/CXCR5, emphasizing its role in orchestrating B-cell migration. This selectivity in chemotactic function and receptor binding positions BCA-1/CXCL13 as a key regulator in the immune system, contributing to the precise recruitment and activation of B-lymphocytes within the cellular microenvironment.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR5. The ED₅₀ for this effect is <20 ng/mL.

Human

E. coli

N-His

O43927 (V23-R94)

10563  [NCBI]

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR

Approximately 9.49 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.