1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. MIP-2/GRO-beta
  6. Animal-Free GRO-beta/CXCL2 Protein, Human (His)

Animal-Free GRO-beta/CXCL2 Protein, Human (His)

Cat. No.: HY-P700045AF
COA Handling Instructions

GRO-beta/CXCL2 Protein, generated by activated monocytes and neutrophils, is prominently expressed at inflammatory sites. Notably, this chemokine, with hematoregulatory properties, suppresses hematopoietic progenitor cell proliferation in vitro. GRO-beta(5-73) displays heightened hematopoietic activity, emphasizing its significant role in regulating hematopoiesis. Animal-Free GRO-beta/CXCL2 Protein, Human (His) is the recombinant human-derived animal-FreeGRO-beta/CXCL2 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free GRO-beta/CXCL2 Protein, Human (His) is 73 a.a., with molecular weight of ~8.7 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $71 In-stock
10 μg $200 In-stock
50 μg $480 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GRO-beta/CXCL2 Protein, generated by activated monocytes and neutrophils, is prominently expressed at inflammatory sites. Notably, this chemokine, with hematoregulatory properties, suppresses hematopoietic progenitor cell proliferation in vitro. GRO-beta(5-73) displays heightened hematopoietic activity, emphasizing its significant role in regulating hematopoiesis. Animal-Free GRO-beta/CXCL2 Protein, Human (His) is the recombinant human-derived animal-FreeGRO-beta/CXCL2 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free GRO-beta/CXCL2 Protein, Human (His) is 73 a.a., with molecular weight of ~8.7 kDa.

Background

GRO-beta/CXCL2, generated by activated monocytes and neutrophils, is prominently expressed at sites of inflammation. This chemokine exhibits hematoregulatory properties, as it has been observed to suppress the proliferation of hematopoietic progenitor cells in vitro. Particularly noteworthy is the heightened hematopoietic activity displayed by GRO-beta(5-73), emphasizing its significant role in regulating hematopoiesis.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <10 ng/mL.

Species

Human

Source

E. coli

Tag

N-His

Accession

P19875 (A35-N107)

Gene ID
Molecular Construction
N-term
His
CXCL2 (A35-N107)
Accession # P19875
C-term
Synonyms
GRO-β/CXCL2; C-X-C motif chemokine 2; MIP2-alpha; HSF
AA Sequence

APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Molecular Weight

Approximately 8.7 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free GRO-beta/CXCL2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free GRO-beta/CXCL2 Protein, Human (His)
Cat. No.:
HY-P700045AF
Quantity:
MCE Japan Authorized Agent: