Animal-Free IL-12 beta Protein, Mouse (His)

IL-12 beta protein is a cytokine that acts as a growth factor for activated T cells and NK cells, enhances lytic activity and stimulates IFN-γ production. It combines with IL23A to form IL-23, a cytokine critical in innate and adaptive immunity. Animal-Free IL-12 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-12 beta protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-12 beta Protein, Mouse (His) is 313 a.a., with molecular weight of ~36.60 kDa.

The IL-12 beta Protein, a cytokine, functions as a growth factor for activated T and NK cells, enhancing the lytic activity of NK/lymphokine-activated killer cells and stimulating the production of IFN-gamma by resting PBMC. Furthermore, it associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine that plays a crucial role in both innate and adaptive immunity. IL-23, when bound to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, preferentially stimulating memory T-cells over naive T-cells and promoting the production of pro-inflammatory cytokines. This interleukin may constitute, along with IL-17, an acute response to infection in peripheral tissues. However, IL-23's involvement extends to inducing autoimmune inflammation, potentially contributing to autoimmune inflammatory diseases, and it may play a significant role in tumorigenesis.

Measure by its ability to induce proliferation in T-cell enriched PBMC. The ED₅₀ for this effect is <0.3 ng/mL.

Mouse

E. coli

C-His

P43432 (M23-S335)

16160  [NCBI]

MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Approximately 36.60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.