1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17A
  6. Animal-Free IL-17A Protein, Mouse (His)

IL-17A protein is an important effector cytokine that activates the NF-kappa-B and MAPkinase pathways through the IL17RA-IL17RC receptor complex to protect host tissues from microbial threats. As a key Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. Animal-Free IL-17A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-17A protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-17A Protein, Mouse (His) is 133 a.a., with molecular weight of ~15.92 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Animal-Free IL-17A Protein, Mouse (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-17A protein is an important effector cytokine that activates the NF-kappa-B and MAPkinase pathways through the IL17RA-IL17RC receptor complex to protect host tissues from microbial threats. As a key Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. Animal-Free IL-17A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-17A protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-17A Protein, Mouse (His) is 133 a.a., with molecular weight of ~15.92 kDa.

Background

IL-17A Protein, an effector cytokine, plays a pivotal role in innate and adaptive immune responses, safeguarding host tissues against microbial threats. Signaling through the IL17RA-IL17RC receptor complex, it activates NF-kappa-B and MAPkinase pathways, orchestrating the transcriptional activation of immune effectors. As a hallmark Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. It acts as part of an inflammatory circuit, promoting bacterial clearance, and is crucial for epithelial barrier integrity during homeostasis and infection. IL-17A enhances antiviral defense and, in synergy with IL-17F, induces the production of antimicrobial peptides. Its homodimeric and heterodimeric structures highlight its diverse interactions in immune regulation.

Biological Activity

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-17A is > 1 x 106 IU/mg.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

Q62386 (A26-A158)

Gene ID
Molecular Construction
N-term
IL-17A (A26-A158)
Accession # Q62386
His
C-term
Synonyms
CTLA8; CTLA-8; IL-17; Interleukin-17A; IL17A
AA Sequence

MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Molecular Weight

Approximately 15.92 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-17A Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-17A Protein, Mouse (His)
Cat. No.:
HY-P700194AF
Quantity:
MCE Japan Authorized Agent: