1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17B
  6. Animal-Free IL-17B Protein, Human (His)

IL-17B Proteinas, crucial in cellular signaling, induces the release of pro-inflammatory cytokines, TNF-α, and IL-1β from THP-1 monocytic cells.Its role in regulating immune responses and inflammatory processes underscores its potential significance in mediating crosstalk between immune cells, contributing to overall immune homeostasis.Animal-Free IL-17B Protein, Human (His) is the recombinant human-derived animal-FreeIL-17B protein, expressed by E.coli , with C-His labeled tag.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-17B Proteinas, crucial in cellular signaling, induces the release of pro-inflammatory cytokines, TNF-α, and IL-1β from THP-1 monocytic cells.Its role in regulating immune responses and inflammatory processes underscores its potential significance in mediating crosstalk between immune cells, contributing to overall immune homeostasis.Animal-Free IL-17B Protein, Human (His) is the recombinant human-derived animal-FreeIL-17B protein, expressed by E.coli , with C-His labeled tag.

Background

IL-17B protein plays a crucial role in cellular signaling by inducing the release of pro-inflammatory cytokines, specifically tumor necrosis factor alpha (TNF-α) and interleukin-1 beta (IL-1β), from the monocytic cell line THP-1. This activity highlights the protein's involvement in the regulation of immune responses and inflammatory processes, emphasizing its potential significance in mediating the crosstalk between immune cells and contributing to the overall immune homeostasis.

Biological Activity

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <49 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q9UHF5 (Q21-F180)

Gene ID
Molecular Construction
N-term
IL-17B (Q21-F180)
Accession # Q9UHF5
His
C-term
Synonyms
Interleukin-17B; IL-17B; Cytokine Zcyto7; IL-20; NIRF; ZCYTO7
AA Sequence

MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF

Molecular Weight

Approximately 19.09 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-17B Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-17B Protein, Human (His)
Cat. No.:
HY-P700105AF
Quantity:
MCE Japan Authorized Agent: