1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17D
  6. Animal-Free IL-17D Protein, Human (His)

Animal-Free IL-17D Protein, Human (His)

Cat. No.: HY-P700106AF
COA Handling Instructions

IL-17D protein acts as a potent inducer, effectively triggering endothelial cells to express key inflammatory mediators such as IL6, CXCL8/IL8, and CSF2/GM-CSF. The ability of this cytokine to stimulate the production of pro-inflammatory signals emphasizes its importance in orchestrating immune responses, particularly in the context of endothelial cell activation. Animal-Free IL-17D Protein, Human (His) is the recombinant human-derived animal-FreeIL-17D protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free IL-17D Protein, Human (His) is 185 a.a., with molecular weight of ~21.00 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $77 In-stock
10 μg $215 In-stock
50 μg $600 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-17D protein acts as a potent inducer, effectively triggering endothelial cells to express key inflammatory mediators such as IL6, CXCL8/IL8, and CSF2/GM-CSF. The ability of this cytokine to stimulate the production of pro-inflammatory signals emphasizes its importance in orchestrating immune responses, particularly in the context of endothelial cell activation. Animal-Free IL-17D Protein, Human (His) is the recombinant human-derived animal-FreeIL-17D protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free IL-17D Protein, Human (His) is 185 a.a., with molecular weight of ~21.00 kDa.

Background

IL-17D protein serves as a potent inducer, effectively triggering the expression of key inflammatory mediators such as IL6, CXCL8/IL8, and CSF2/GM-CSF from endothelial cells. This cytokine's ability to stimulate the production of pro-inflammatory signals underscores its significance in orchestrating immune responses, particularly within the context of endothelial cell activation. The induced expression of interleukins and chemokines suggests a crucial role for IL-17D in shaping the inflammatory milieu and contributing to the regulation of immune and inflammatory processes mediated by endothelial cells.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q8TAD2 (A18-P202)

Gene ID
Molecular Construction
N-term
His
IL-17D (A18-P202)
Accession # Q8TAD2
C-term
Synonyms
Interleukin-17D; IL-17D; IL17D
AA Sequence

APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP

Molecular Weight

Approximately 21.00 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-17D Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-17D Protein, Human (His)
Cat. No.:
HY-P700106AF
Quantity:
MCE Japan Authorized Agent: