1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17D
  6. Animal-Free IL-17D Protein, Human (His)

Animal-Free IL-17D Protein, Human (His)

Cat. No.: HY-P700106AF
COA Handling Instructions

IL-17D protein acts as a potent inducer, effectively triggering endothelial cells to express key inflammatory mediators such as IL6, CXCL8/IL8, and CSF2/GM-CSF. The ability of this cytokine to stimulate the production of pro-inflammatory signals emphasizes its importance in orchestrating immune responses, particularly in the context of endothelial cell activation. Animal-Free IL-17D Protein, Human (His) is the recombinant human-derived animal-FreeIL-17D protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free IL-17D Protein, Human (His) is 185 a.a., with molecular weight of ~21.00 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $77 In-stock
10 μg $215 In-stock
50 μg $600 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-17D protein acts as a potent inducer, effectively triggering endothelial cells to express key inflammatory mediators such as IL6, CXCL8/IL8, and CSF2/GM-CSF. The ability of this cytokine to stimulate the production of pro-inflammatory signals emphasizes its importance in orchestrating immune responses, particularly in the context of endothelial cell activation. Animal-Free IL-17D Protein, Human (His) is the recombinant human-derived animal-FreeIL-17D protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free IL-17D Protein, Human (His) is 185 a.a., with molecular weight of ~21.00 kDa.

Background

IL-17D protein serves as a potent inducer, effectively triggering the expression of key inflammatory mediators such as IL6, CXCL8/IL8, and CSF2/GM-CSF from endothelial cells. This cytokine's ability to stimulate the production of pro-inflammatory signals underscores its significance in orchestrating immune responses, particularly within the context of endothelial cell activation. The induced expression of interleukins and chemokines suggests a crucial role for IL-17D in shaping the inflammatory milieu and contributing to the regulation of immune and inflammatory processes mediated by endothelial cells.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q8TAD2 (A18-P202)

Gene ID
Molecular Construction
N-term
His
IL-17D (A18-P202)
Accession # Q8TAD2
C-term
Synonyms
Interleukin-17D; IL-17D; IL17D
AA Sequence

APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP

Molecular Weight

Approximately 21.00 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-17D Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-17D Protein, Human (His)
Cat. No.:
HY-P700106AF
Quantity:
MCE Japan Authorized Agent: