1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-21
  5. Animal-Free IL-21 Protein, Human (His)

IL-21 protein is an immunomodulatory cytokine that promotes the transition from innate immunity to adaptive immunity. It induces B cells to produce IgG(1) and IgG(3), harnessing an effective antibody response to fight viral infections. Animal-Free IL-21 Protein, Human (His) is the recombinant human-derived animal-FreeIL-21 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-21 protein is an immunomodulatory cytokine that promotes the transition from innate immunity to adaptive immunity. It induces B cells to produce IgG(1) and IgG(3), harnessing an effective antibody response to fight viral infections. Animal-Free IL-21 Protein, Human (His) is the recombinant human-derived animal-FreeIL-21 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IL-21 Protein, a cytokine with immunoregulatory activity, serves as a pivotal mediator in orchestrating the interplay between innate and adaptive immunity. Notably, it induces the production of IgG(1) and IgG(3) in B-cells, emphasizing its role in shaping humoral immune responses. Additionally, IL-21 is intricately involved in the generation and maintenance of T follicular helper (Tfh) cells, playing a crucial part in the formation of germinal centers—an essential process in adaptive immunity. Collaborating with IL6, it contributes to the early generation of Tfh cells, proving critical for mounting an effective antibody response during acute viral infections. Furthermore, IL-21 may play a role in the proliferation and maturation of natural killer (NK) cells, particularly in synergy with IL15. Its regulatory influence extends to mature B- and T-cells, modulating their proliferation in response to activating stimuli. In concert with IL15 and IL18, IL-21 stimulates interferon gamma production in T-cells and NK cells, highlighting its multifaceted impact on immune responses. During T-cell-mediated immune responses, IL-21 exhibits the potential to inhibit dendritic cells (DC) activation and maturation, adding another layer to its regulatory repertoire.

Biological Activity

Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is <10 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q9HBE4-1 (Q32-S162)

Gene ID
Molecular Construction
N-term
IL-21 (Q32-S162)
Accession # Q9HBE4-1
His
C-term
Synonyms
Interleukin-21; IL-21; Za11; IL21
AA Sequence

MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS

Molecular Weight

Approximately 16.2 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-21 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-21 Protein, Human (His)
Cat. No.:
HY-P700112AF
Quantity:
MCE Japan Authorized Agent: