Animal-Free IL-27 EBI3 Protein, Mouse (His)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling. Animal-Free IL-27 EBI3 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-27 EBI3 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-27 EBI3 Protein, Mouse (His) is 206 a.a., with molecular weight of ~23.84 kDa.

IL-12, in association with IL23A, forms the IL-23 interleukin, a heterodimeric cytokine that plays essential roles in innate and adaptive immunity. This cytokine is implicated in the acute response to infection in peripheral tissues and binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activating the Jak-Stat signaling cascade. IL-23 stimulates memory T-cells rather than naive T-cells and promotes the production of pro-inflammatory cytokines. It has been identified as a contributor to autoimmune inflammation, potentially responsible for autoimmune inflammatory diseases and implicated in tumorigenesis. Additionally, IL-12 functions as a growth factor for activated T and NK cells, enhancing the lytic activity of NK/lymphokine-activated killer cells, and stimulating interferon-gamma production by resting PBMC.

Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <5 ng/mL.

Mouse

E. coli

C-His

O35228 (A23-P228)

50498  [NCBI]

MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP

Approximately 23.84 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.