Animal-Free MCP-1/CCL2 Protein, Mouse (His)

The MCP-1/CCL2 protein, as a CCR2 ligand, induces potent chemotactic responses and intracellular calcium mobilization in monocytes and basophils, without affecting neutrophils or eosinophils.It is critical for neuropathic pain and enhances NMDA-mediated synaptic transmission in neurons containing dopamine D1 and D2 receptors, possibly involving MAPK/ERK-dependent GRIN2B/NMDAR2B phosphorylation.Animal-Free MCP-1/CCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMCP-1/CCL2 protein, expressed by E.coli , with N-His labeled tag.

MCP-1/CCL2 protein acts as a ligand for C-C chemokine receptor CCR2, initiating a robust chemotactic response and intracellular calcium mobilization through CCR2 binding and activation. It demonstrates chemotactic activity for monocytes and basophils while not affecting neutrophils or eosinophils. Playing a pivotal role in mediating peripheral nerve injury-induced neuropathic pain, MCP-1/CCL2 also enhances NMDA-mediated synaptic transmission in both dopamine D1 and D2 receptor-containing neurons, potentially involving MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B. Existing as a monomer or homodimer in equilibrium, it is tethered to endothelial cells by glycosaminoglycan (GAG) side chains of proteoglycans and interacts with TNFAIP6 through its Link domain.

Measure by its ability to chemoattract BaF3 cells transfected with CCR2A. The ED₅₀ for this effect is <8 ng/mL.

Mouse

E. coli

N-His

P10148 (Q24-N148)

20296  [NCBI]

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN

Approximately 14.65 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.