1. Recombinant Proteins
  2. Others
  3. Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO)

Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO)

Cat. No.: HY-P72082
Handling Instructions Technical Support

Apolipoprotein C-III (APOC3) is a component of VLDL and HDL and plays a crucial role in triglyceride homeostasis. Intracellularly, it facilitates the assembly and secretion of VLDL1 for lipid transport. Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Apolipoprotein C-III/APOC3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO) is 79 a.a., with molecular weight of ~24.9 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Apolipoprotein C-III (APOC3) is a component of VLDL and HDL and plays a crucial role in triglyceride homeostasis. Intracellularly, it facilitates the assembly and secretion of VLDL1 for lipid transport. Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Apolipoprotein C-III/APOC3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO) is 79 a.a., with molecular weight of ~24.9 kDa.

Background

Apolipoprotein C-III (APOC3) protein is a vital component of both triglyceride-rich very low-density lipoproteins (VLDL) and high-density lipoproteins (HDL) in plasma, playing a multifaceted role in triglyceride homeostasis. Intracellularly, APOC3 facilitates the assembly and secretion of hepatic very low-density lipoprotein 1 (VLDL1), contributing to lipid transport. Extracellularly, it serves to modulate the hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs), impairing their lipolysis by inhibiting lipoprotein lipase and impeding their hepatic uptake through remnant receptors. Structurally, APOC3 is characterized by several curved helices connected via semiflexible hinges, allowing it to wrap tightly around the curved micelle surface and adapt easily to the different diameters of its natural binding partners. This structural flexibility underscores its versatile involvement in lipid metabolism and transport processes.

Species

Mouse

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P33622 (E21-S99)

Gene ID
Molecular Construction
N-term
6*His-SUMO
APOC3 (E21-S99)
Accession # P33622
C-term
Synonyms
Apoc3Apolipoprotein C-III; Apo-CIII; ApoC-III; Apolipoprotein C3
AA Sequence

EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES

Molecular Weight

Approximately 22 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO)
Cat. No.:
HY-P72082
Quantity:
MCE Japan Authorized Agent: