APT Protein, Streptococcus pyogenes serotype M1 (Baculovirus, His-Myc)

APT, also known as adenine phosphoribosyltransferase, plays a crucial role in the rescue reaction that forms AMP (adenosine monophosphate). This salvage pathway provides a more energy-efficient route for AMP synthesis than de novo synthesis. APT Protein, Streptococcus pyogenes serotype M1 (Baculovirus, His-Myc) is the recombinant APT protein, expressed by Sf9 insect cells , with N-10*His, C-Myc labeled tag. The total length of APT Protein, Streptococcus pyogenes serotype M1 (Baculovirus, His-Myc) is 172 a.a., with molecular weight of ~22.7 kDa.

APT, also known as adenine phosphoribosyltransferase, plays a crucial role in a salvage reaction that enables the formation of AMP (adenosine monophosphate). This salvage pathway offers a more energetically efficient route for AMP synthesis compared to de novo synthesis. By catalyzing the transfer of a phosphoribosyl group from PRPP (5-phosphoribosyl-1-pyrophosphate) to adenine, APT contributes to the recycling and utilization of adenine nucleotides, ensuring their availability for various cellular processes. Understanding the precise mechanisms and regulation of APT-mediated salvage reactions can provide insights into nucleotide metabolism and the maintenance of cellular energy balance.

Others

Sf9 insect cells

N-10*His;C-Myc

P63546 (M1-G172)

/

MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG

Approximately 22.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.