1. Recombinant Proteins
  2. CD Antigens
  3. Erythrocyte CD Proteins Endothelial cell CD Proteins
  4. CD297/ART4
  5. ART4/CD297 Protein, Mouse (HEK293, His)

ART4/CD297 Protein , a protein that contains a mono-ADP-ribosylation (ART) motif, is involved in peptidyl-arginine ADP-ribosylation. It is a member of the ADP-ribosyltransferase gene family. ART4 is expressed in several structures, including cardiovascular system, genitourinary system, integumental system, liver; and sensory organ. In addition, ART4 plays an important role in erythrocyte invasion by P. falciparum. ART4/CD297 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ART4/CD297 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ART4/CD297 Protein , a protein that contains a mono-ADP-ribosylation (ART) motif, is involved in peptidyl-arginine ADP-ribosylation. It is a member of the ADP-ribosyltransferase gene family. ART4 is expressed in several structures, including cardiovascular system, genitourinary system, integumental system, liver; and sensory organ. In addition, ART4 plays an important role in erythrocyte invasion by P. falciparum. ART4/CD297 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ART4/CD297 protein, expressed by HEK293 , with C-His labeled tag.

Background

Ecto-ADP-ribosyltransferase 4 (ART4), a protein that contains a mono-ADP-ribosylation (ART) motif, is involved in peptidyl-arginine ADP-ribosylation. It is a member of the ADP-ribosyltransferase gene family. ART4 is expressed in several structures, including cardiovascular system, genitourinary system, integumental system, liver; and sensory organ. The prediction of NAD+ ADP-ribosyltransferase activity emphasizes its potential involvement in post-translational modification processes, particularly in the context of peptidyl-arginine ADP-ribosylation, contributing to the functional diversity of this enzyme. In addition, ART4 plays an important role in erythrocyte invasion by P. falciparum[1].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9CRA0 (G24-K263)

Gene ID
Molecular Construction
N-term
ART4 (G24-K263)
Accession # Q9CRA0
His
C-term
Synonyms
Ecto-ADP-ribosyltransferase 4; ARTC4; Mono(ADP-ribosyl)transferase 4; DO; DOK1
AA Sequence

GSTEAPLKVDVDLTPDSFDDQYQGCSEQMVEELNQGDYFIKEVDTHKYYSRAWQKAHLTWLNQAKALPESMTPVHAVAIVVFTLNLNVSSDLAKAMARAAGSPGQYSQSFHFKYLHYYLTSAIQLLRKDSSTKNGSLCYKVYHGMKDVSIGANVGSTIRFGQFLSASLLKEETRVSGNQTLFTIFTCLGASVQDFSLRKEVLIPPYELFEVVSKSGSPKGDLINLRSAGNMSTYNCQLLK

Molecular Weight

Approximately 38-45 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ART4/CD297 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ART4/CD297 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77300
Quantity:
MCE Japan Authorized Agent: