1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. B3GNT2 Protein, Human (HEK293, Fc)

The B3GNT2 protein is a member of the zinc-containing alcohol dehydrogenase family and facilitates the oxidation of alcohols to their corresponding carbonyl compounds. This enzyme is widely distributed in organisms, has zinc ions in its active site, and catalyzes substrate conversion through dehydrogenation. B3GNT2 Protein, Human (HEK293, Fc) is the recombinant human-derived B3GNT2 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
5 μg Ask For Quote & Lead Time
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The B3GNT2 protein is a member of the zinc-containing alcohol dehydrogenase family and facilitates the oxidation of alcohols to their corresponding carbonyl compounds. This enzyme is widely distributed in organisms, has zinc ions in its active site, and catalyzes substrate conversion through dehydrogenation. B3GNT2 Protein, Human (HEK293, Fc) is the recombinant human-derived B3GNT2 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

Alcohol dehydrogenase, a member of the zinc-containing alcohol dehydrogenase family, plays a crucial role in the oxidation of alcohols to their corresponding carbonyl compounds. This enzyme, widely distributed across various organisms, facilitates the metabolism of ethanol and other aliphatic alcohols. The zinc ion, a structural component of the active site, is instrumental in catalyzing the conversion of substrates through the dehydrogenation reaction. Beyond its pivotal role in alcohol metabolism, alcohol dehydrogenase is implicated in diverse physiological processes, contributing to the detoxification of alcohols and maintaining cellular redox balance. The presence of this enzyme family underscores its evolutionary significance and physiological importance across different biological systems.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q9NY97-1 (K29-C397)

Gene ID
Molecular Construction
N-term
hFc
B3GNT2 (K29-C397)
Accession # Q9NY97-1
C-term
Synonyms
N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2; B3GALT7; B3GNT1
AA Sequence

KSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC

Molecular Weight

Approximately 95-130 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

B3GNT2 Protein, Human (HEK293, Fc) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B3GNT2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76160
Quantity:
MCE Japan Authorized Agent: