1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily Macrophage CD Proteins
  4. TNF Receptor Superfamily BAFF R/CD268
  5. BAFF Receptor
  6. BAFFR/TNFRSF13C Protein, Human

BAFF Receptor (B-cell activating factor receptor, BAFF-R), also known as TNFRSF13C and BR3, is a membrane protein of the TNF receptor superfamily which recognizes BAFF. BAFF Receptor is the crucial receptor for B-cell survival and also is a potent costimulator of both B and T cell activation. BAFFR/TNFRSF13C Protein, Human is a recombinant protein produced in E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

BAFF Receptor (B-cell activating factor receptor, BAFF-R), also known as TNFRSF13C and BR3, is a membrane protein of the TNF receptor superfamily which recognizes BAFF. BAFF Receptor is the crucial receptor for B-cell survival and also is a potent costimulator of both B and T cell activation[1]. BAFFR/TNFRSF13C Protein, Human is a recombinant protein produced in E. coli.

Background

BAFF Receptor is expressed on all B cells (except plasma cells), including immature, transitional, mature, memory, and germinal center B cells, as well as on plasma cells[2], while BAFF-R is also expressed on follicular helper T cells (TFH)[3].
The amino acid sequence of human BAFF Receptor protein has low homology for mouse and rat BAFF Receptor protein.
BAFF Receptor binds to BAFF and recruits TNF receptor-associated factor 3 (TRAF-3) and TRAF-2 to the intracellular domain of BAFF-R molecules. The binding of TRAF3 to the BAFF-R reverses the inhibitory effect of unbound/cytoplasmic TRAF3 on the alternative NF-κB2 signaling pathway. It releases NF-κB-inducing kinase (NIK), which phosphorylates inhibitor of κB kinase 1 (IKK1) leading to activation of non-canonical NF-κB. BAFF-R signaling is critical for peripheral B cell survival and differentiation, germinal center formation, plasma cell survival, and IgG and IgE class switching[2].
BAFF Receptor binds to BAFF mediates B-cell survival, proliferation, and differentiation, and involves in the formation of GCs in secondary follicles in murine models and tertiary lymphoid structures in autoimmune diseases[3]. BAFF/BAFF-R signaling is crucial for primary B cell survival, differentiation and homeostasis[4]. A/WySnJ mice expressing a defective BAFF-R have disrupted B cell maturation, similar to that seen in BAFF-deficient mice[5].

In Vitro

BAFF Receptor (human) (500 ng/mL; 30 min) inhibits BAFF-mediated proliferation of human mesangial cells when co-cultured with 20 ng/mL BAFF for 48h[4].

In Vivo

Human BAFF-R deficiency strongly impairs the development and homeostasis of follicular, IgM memory/marginal zone, and class-switched memory B cells[6].

Biological Activity

Fully biologically active when compared to standard. The ED50 as determined by its ability to block BAFF induced mouse splenocyte survival is 1.0-5.0 μg/mL in the presence of 1.0 μg/mL of rHuBAFF.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q96RJ3-1 (M1-G76)

Gene ID
Molecular Construction
N-term
BAFFR (M1-G76)
Accession # Q96RJ3-1
C-term
Synonyms
rHuBAFF-R; CD268; TNFRSF13C; BR3
AA Sequence

MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG

Molecular Weight

Approximately 7.8 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 8.0, 500 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BAFFR/TNFRSF13C Protein, Human
Cat. No.:
HY-P7130
Quantity:
MCE Japan Authorized Agent: