BD-1 Protein, Human

BD-1 Protein, Human is an antimicrobial peptide that defends epithelial surfaces including the skin, gastrointestinal, and respiratory tracts.

Recombinant Human Beta Defensin-1 is an antimicrobial peptide that defends epithelial surfaces including the skin, gastrointestinal, and respiratory tracts^[1]. Human Beta Defensin-1 may provide a fast-acting antimicrobial coating of tubular lumens in the upper urinary tract to prevent infection by inhibiting bacterial attachment to the urothelium and serving as a second-line chemical shield^[2].

Full biological activity determined by a chemotaxis bioassay using CD34+ dendritic cells is in a concentration range of 100-1000 ng/mL.

Human

E. coli

Tag Free

P60022 (G22-K68)

1672  [NCBI]

GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Approximately 5.1 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PBS, pH 7.4, 130 mM NaCl.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Valore EV, et al. Human beta-defensin-1: an antimicrobial peptide of urogenital tissues. J Clin Invest. 1998 Apr 15;101(8):1633-42.  [Content Brief]

  [2]. Becknell B, et al. Expression and antimicrobial function of beta-defensin 1 in the lower urinary tract. PLoS One. 2013 Oct 21;8(10):e77714.  [Content Brief]