1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Butyrophilins
  4. BTN3A1/CD277
  5. BTN3A1/CD277 Protein, Human (HEK293, His)

BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (HEK293, His) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (HEK293, His) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The BTN3A1/CD277 protein is involved in crucial functions related to T-cell activation and the adaptive immune response. It acts as a regulator of activated T-cell proliferation and controls the release of cytokines and IFNG by these cells. Additionally, it plays a role in mediating the response of T-cells towards infected and transformed cells that exhibit elevated levels of phosphorylated metabolites, such as isopentenyl pyrophosphate. The BTN3A1/CD277 protein functions as a homodimer.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O00481-1 (Q30-G254)

Gene ID
Molecular Construction
N-term
BTN3A1 (Q30-G254)
Accession # O00481-1
6*His
C-term
Synonyms
Butyrophilin subfamily 3 member A1; CD277; BTN3A1; BTF5
AA Sequence

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Molecular Weight

28-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BTN3A1/CD277 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BTN3A1/CD277 Protein, Human (HEK293, His)
Cat. No.:
HY-P72763
Quantity:
MCE Japan Authorized Agent: