1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. Cell Adhesion Molecule 3 (CADM3)
  6. CADM3 Protein, Rat (HEK293, His)

CADM3 protein is a multifunctional cell adhesion molecule that participates in calcium-independent homophilic and heterophilic intercellular adhesion together with IGSF4, NECTIN1, and NECTIN3. Its interaction with EPB41L1 regulates cell-cell connections. CADM3 Protein, Rat (HEK293, His) is the recombinant rat-derived CADM3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CADM3 protein is a multifunctional cell adhesion molecule that participates in calcium-independent homophilic and heterophilic intercellular adhesion together with IGSF4, NECTIN1, and NECTIN3. Its interaction with EPB41L1 regulates cell-cell connections. CADM3 Protein, Rat (HEK293, His) is the recombinant rat-derived CADM3 protein, expressed by HEK293 , with C-His labeled tag.

Background

CADM3, a cell adhesion molecule, intricately participates in cell-cell adhesion processes. It exhibits both calcium-independent homophilic cell-cell adhesion activity and calcium-independent heterophilic cell-cell adhesion activity with IGSF4, NECTIN1, and NECTIN3, emphasizing its versatility in mediating diverse cell interactions. Furthermore, CADM3's interaction with EPB41L1 suggests a potential role in regulating the structure or function of cell-cell junctions. The protein forms homodimers and has the capacity to create trans-heterodimers with NECTIN3, highlighting its ability to engage in various adhesive interactions. Additionally, CADM3 interacts with EPB41L1, DLG3, PALS2, and CASK, further underscoring its involvement in intricate cellular signaling and junction dynamics. The multifaceted nature of CADM3 positions it as a key player in cell adhesion and intercellular communication.

Biological Activity

Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.727 μg/mL, corresponding to a specific activity is 5790.388 units/mg.

  • Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.727 μg/mL, corresponding to a specific activity is 5790.388 units/mg.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q1WIM3 (N23-H328)

Gene ID
Molecular Construction
N-term
CADM3 (N23-H328)
Accession # Q1WIM3
6*His
C-term
Synonyms
Cell adhesion molecule 3; IgSF4B; NECL-1; Syncam3
AA Sequence

NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVSSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKETATLNCQSSGSKPAAQLAWRKGDQELHGDQTRIQEDPNGKTFTVSSSVSFQVTRDDDGANVVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPEPAHPREGQKLLLHCEGRGNPVPQQYVWVKEGSEPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYTAYFTLNVNDPSPVPSSSSTYH

Molecular Weight

Approximately 35-45 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CADM3 Protein, Rat (HEK293, His)
Cat. No.:
HY-P76758
Quantity:
MCE Japan Authorized Agent: