1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4) Carbonic Anhydrase
  4. Carbonic Anhydrase 14 (CA-XIV)
  5. Carbonic Anhydrase 14 Protein, Human (HEK293, His)

Carbonic Anhydrase 14 Protein, Human (HEK293, His)

Cat. No.: HY-P72867
Handling Instructions Technical Support

Carbonic Anhydrase 14 Protein catalyzes the reversible hydration of carbon dioxide, converting it to bicarbonate ions and protons, and vice versa. Its vital enzymatic activity contributes to physiological processes, regulating acid-base balance, respiration, and cellular pH homeostasis. The protein plays a pivotal role in carbon dioxide transport and metabolism in the body. Carbonic Anhydrase 14 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 14 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
10 μg Get quote
50 μg Get quote
100 μg Get quote

* Please select Quantity before adding items.

Carbonic Anhydrase 14 Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Carbonic Anhydrase 14 Protein catalyzes the reversible hydration of carbon dioxide, converting it to bicarbonate ions and protons, and vice versa. Its vital enzymatic activity contributes to physiological processes, regulating acid-base balance, respiration, and cellular pH homeostasis. The protein plays a pivotal role in carbon dioxide transport and metabolism in the body. Carbonic Anhydrase 14 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 14 protein, expressed by HEK293 , with C-His labeled tag.

Background

Carbonic Anhydrase 14 Protein is an enzyme that catalyzes the reversible hydration of carbon dioxide. Its main function is to facilitate the conversion of carbon dioxide to bicarbonate ions and protons, and vice versa. This enzymatic activity is crucial in various physiological processes, including acid-base balance regulation, respiration, and maintenance of cellular pH homeostasis. Carbonic Anhydrase 14 Protein plays a pivotal role in carbon dioxide transport and metabolism within the body.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q9ULX7/NP_036245.1 (A16-M290)

Gene ID
Molecular Construction
N-term
Carbonic Anhydrase 14 (A16-M290)
Accession # Q9ULX7/NP_036245.1
His
C-term
Synonyms
Carbonic anhydrase 14; Carbonate dehydratase XIV; CA-XIV; CA14
AA Sequence

MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEM

Molecular Weight

45-48 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Carbonic Anhydrase 14 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 14 Protein, Human (HEK293, His)
Cat. No.:
HY-P72867
Quantity:
MCE Japan Authorized Agent: