Carbonic Anhydrase 14 Protein, Human (His)

Carbonic Anhydrase 14 Protein, Human (His) is an approximately 40.0 kDa human carbonic anhydrase 14 protein with a His-flag. Carbonic Anhydrase 14 is a type I membrane enzyme highly expressed in all parts of the central nervous system^[1].

Carbonic AnHYdrase XIV is a type I membrane enzyme highly expressed in all parts of the central nervous system. And it exhibits lower expression in adult liver, heart, kidney, urinary bladder, and skeletal muscle^[1].
The carbonic anhydrasekl (CA) family consists of at least 11 enzymatically active members and a few inactive homologous proteins^[2].
The carbonic anhydrases are indentified as metalloenzyme for its zinc ion prosthetic group, it can catalyze the rapid interconversion of carbon dioxide and water to bicarbonate and protons. They also take part in maintaining acid-base balance in blood and other tissues^[2].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

Q9ULX7 (G19-M290)

23632  [NCBI]

HHHHHHGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEM

Approximately 40.0 kDa

Greater than 85% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filter solution of 20 mM Tris, 150 mM NaCl, 10% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. D Hewett-Emmett, et al. Functional diversity, conservation, and convergence in the evolution of the alpha-, beta-, and gamma-carbonic anhydrase gene families. Mol Phylogenet Evol  [Content Brief]

  [2]. K Fujikawa-Adachi, et al. Human carbonic anhydrase XIV (CA14): cDNA cloning, mRNA expression, and mapping to chromosome 1. Genomics. 1999 Oct 1;61(1):74-81.  [Content Brief]