Cathepsin B Protein, Mouse (HEK293, His)

Cathepsin B Protein, Mouse (HEK293, His) is an approximately 32-50 kDa Cathepsin B protein with a His-flag. Cathepsin B is an enzymatic protein belonging to the peptidase C1 family^[1].

Cathepsin B (CTSB) is also known as APP secretase (APPS) and CPSB, is an enzymatic protein belonging to the peptidase C1 family^[1].
Cathepsin B/CTSB is synthesized as a preproenzyme and is activated in prelysosomal acidic vesicles (late endosomes) prior to its delivery to lysosomes. After removal of the signal peptide, the inactive proenzyme undergoes modifications including removal of the pro region to result in the active enzyme^[1].
Several lysosomal proteinases including the cathepsin B have been implicated in malignant progression of tumors. Many researchers have demonstrated correlations between increased activity of cathepsin B and increased metastatic capability of animal tumors or malignancy of human tumors^[2].

Measured by its ability to cleave 10μM fluorogenic peptide 10μM substrate Z-LR-AMC. The specific activity is 47491.133 pmol/min/µg, as measured under the described conditions.

Mouse

HEK293

C-6*His

P10605 (H18-F339)

13030  [NCBI]

HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRFHHHHHH

32-50 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS, pH7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Izabela Podgorski, et al. Cathepsin B and its role(s) in cancer progression. Biochem Soc Symp. 2003;(70):263-76.  [Content Brief]

  [2]. W Morikawa, et al. Angiostatin generation by cathepsin D secreted by human prostate carcinoma cells. J Biol Chem. 2000 Dec 8;275(49):38912-20.  [Content Brief]