1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin D
  5. Cathepsin D Protein, Human (HEK293, C-His)

Cathepsin D protein is an acidic protease that actively participates in intracellular protein breakdown. Studies have shown that it is critical in the processing of amyloid precursor protein (APP), with ADAM30-mediated cleavage and activation leading to APP degradation. Cathepsin D Protein, Human (HEK293, C-His) is the recombinant human-derived Cathepsin D protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cathepsin D protein is an acidic protease that actively participates in intracellular protein breakdown. Studies have shown that it is critical in the processing of amyloid precursor protein (APP), with ADAM30-mediated cleavage and activation leading to APP degradation. Cathepsin D Protein, Human (HEK293, C-His) is the recombinant human-derived Cathepsin D protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Cathepsin D, an acid protease, exerts its activity in the intracellular breakdown of proteins. This protease is implicated in the processing of amyloid precursor protein (APP), with its cleavage and activation by ADAM30 leading to the degradation of APP, as evidenced in studies. Cathepsin D's involvement extends to the pathogenesis of various diseases, including breast cancer, and it is suggested to play a role in Alzheimer's disease, highlighting its significance in cellular processes and potential connections to pathological conditions.

Biological Activity

Measured by its ability to cleave a peptide substrate, Mca-PLGL-Dpa-AR-NH2. The specific activity is 4624.96 pmol/min/µg, as measured under the described conditions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P07339 (L21-L412)

Gene ID
Molecular Construction
N-term
Cathepsin D (L21-L412)
Accession # P07339
6*His
C-term
Synonyms
rHuCathepsin D, His; Cathepsin D; CTSD; CPSD
AA Sequence

LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH

Molecular Weight

Approximately 44.78 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cathepsin D Protein, Human (HEK293, C-His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin D Protein, Human (HEK293, C-His)
Cat. No.:
HY-P7748A
Quantity:
MCE Japan Authorized Agent: