1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin W
  5. Cathepsin W/CTSW Protein, Mouse (His, Myc)

Cathepsin W/CTSW Protein, Mouse (His, Myc)

Cat. No.: HY-P72281
SDS COA Handling Instructions

Cathepsin W/CTSW is implicated in potentially regulating T-cell cytolytic activity, suggesting a role in immune response processes. Recognizing its potential function underscores its significance in immune defense against pathogens. The precise mechanisms of Cathepsin W in T-cell regulation remain an area of interest, highlighting its potential as a key player in immune system function and cellular defense orchestration. Cathepsin W/CTSW Protein, Mouse (His, myc) is the recombinant mouse-derived Cathepsin W/CTSW, expressed by E. coli , with C-Myc, N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cathepsin W/CTSW is implicated in potentially regulating T-cell cytolytic activity, suggesting a role in immune response processes. Recognizing its potential function underscores its significance in immune defense against pathogens. The precise mechanisms of Cathepsin W in T-cell regulation remain an area of interest, highlighting its potential as a key player in immune system function and cellular defense orchestration. Cathepsin W/CTSW Protein, Mouse (His, myc) is the recombinant mouse-derived Cathepsin W/CTSW, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Background

Cathepsin W/CTSW is implicated in potentially having a specific role in the mechanism or regulation of T-cell cytolytic activity, suggesting its involvement in the intricate processes governing the immune response. The recognition of its potential function in T-cell cytolytic activity underscores its significance in the immune system's defense against pathogens and abnormal cells. The precise mechanisms by which Cathepsin W operates in the regulation of T-cell activity remain an area of interest, highlighting its potential as a key player in immune system function and the orchestration of cellular defense mechanisms.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

E. coli

Tag

C-Myc;N-10*His

Accession

P56203 (V126-P371)

Gene ID
Molecular Construction
N-term
10*His
CTSW (V126-P371)
Accession # P56203
C-term
Synonyms
CtswCathepsin W; Lymphopain
AA Sequence

VPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQALWRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPFQGDRKPHRCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSSCDPRQVDHSVLLVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNNTCGVTKYPFTAQVDSPVKKARTSCPP

Molecular Weight

Approximately 35.2 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<14 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cathepsin W/CTSW Protein, Mouse (His, Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin W/CTSW Protein, Mouse (His, Myc)
Cat. No.:
HY-P72281
Quantity:
MCE Japan Authorized Agent: