CD14 Protein, Human (HEK293, His)

CD14 Protein, Human (HEK293, His) is a recombinant human CD14 expressed in HEK 293 cells with a His tag at the N-terminus. CD14 Protein is an efficient target for recombinant immunoglobulin vaccine constructs that deliver T cell epitopes^[1][2].

CD14, preferentially expressed on the surface of monocytes/macrophages, is a glycophosphatidylinositol‐linked protein, which is also part of the lipopolysaccharide (LPS) receptor complex. CD14 binds LPS and acts as a pattern recognition receptor (PRR). In addition to binding LPS and other bacterial products such as peptidoglycan and lipomannans, human CD14 has been suggested to mediate phagocytosis of bacteria and apoptotic cells^[1][2].

Human

HEK293

C-6*His

P08571 (T20-C352)

929  [NCBI]

TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPAC

Approximately 54 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Wright SD, et, al. CD14, a receptor for complexes of lipopolysaccharide (LPS) and LPS binding protein. Science. 1990 Sep 21;249(4975):1431-3.  [Content Brief]

  [2]. Tunheim G, et, al. Human CD14 is an efficient target for recombinant immunoglobulin vaccine constructs that deliver T cell epitopes. J Leukoc Biol. 2005 Mar;77(3):303-10.  [Content Brief]