CD28 Protein, Mouse (HEK293, Fc-His)

CD28 Protein, a crucial regulator of T-cell activation, promotes cell proliferation, cytokine production, and T-cell survival. It enhances IL4 and IL10 production when combined with TCR/CD3 ligation and CD40L costimulation. CD28 Protein exists as a disulfide-linked homodimer and interacts with DUSP14, CD80/B7-1, CD86/B7-2/B70, and GRB2 (By similarity). CD28 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived CD28 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

CD28 Protein, a key player in T-cell activation, is involved in inducing cell proliferation, cytokine production, and promoting T-cell survival. It enhances the production of IL4 and IL10 in T-cells when combined with TCR/CD3 ligation and CD40L costimulation. CD28 Protein exists as a homodimer through disulfide-linkage and interacts with DUSP14. It binds to CD80/B7-1 and CD86/B7-2/B70, and also has an interaction with GRB2 (By similarity).

Mouse

HEK293

C-hFc;C-6*His

P31041 (N20-K149)

12487  [NCBI]

NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPK

Approximately 60.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.