1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. CD300a
  5. CD300a/LMIR1 Protein, Human (HEK293, His)

CD300a/LMIR1 Protein, Human (HEK293, His)

Cat. No.: HY-P72738
Handling Instructions

CD300a/LMIR1 Protein, an inhibitory receptor, potentially diminishes cytolytic activity in NK cells and suppresses mast cell degranulation. It serves as a negative regulator in MYD88-mediated TLR signaling, activating PTPN6 but not TRIF. Upon tyrosine phosphorylation, CD300a/LMIR1 engages with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D, showcasing its multifaceted involvement in immune regulation and cellular responses. CD300a/LMIR1 Protein, Human (HEK293, His) is the recombinant human-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD300a/LMIR1 Protein, an inhibitory receptor, potentially diminishes cytolytic activity in NK cells and suppresses mast cell degranulation. It serves as a negative regulator in MYD88-mediated TLR signaling, activating PTPN6 but not TRIF. Upon tyrosine phosphorylation, CD300a/LMIR1 engages with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D, showcasing its multifaceted involvement in immune regulation and cellular responses. CD300a/LMIR1 Protein, Human (HEK293, His) is the recombinant human-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD300a/LMIR1, an inhibitory receptor, potentially plays a role in diminishing cytolytic activity in natural killer (NK) cells and suppressing mast cell degranulation. Additionally, it acts as a negative regulator in Toll-like receptor (TLR) signaling mediated by MYD88, although not TRIF, by activating PTPN6. Upon tyrosine phosphorylation, CD300a/LMIR1 engages with PTN6/SHP-1 and PTPN11/SHP-2, as well as INPP5D, illustrating its multifaceted involvement in immune regulation and cellular responses.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9UGN4-1 (L18-Q178)

Gene ID
Molecular Construction
N-term
CD300A (L18-Q178)
Accession # Q9UGN4-1
6*His
C-term
Synonyms
CMRF35-like molecule 8; CLM-8; CMRF35-H9; IgSF12; IRp60; CD300a; CMRF35H; IGSF12
AA Sequence

LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQ

Molecular Weight

Approximately 33 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD300a/LMIR1 Protein, Human (HEK293, His)
Cat. No.:
HY-P72738
Quantity:
MCE Japan Authorized Agent: