CD40 Protein, Rhesus Macaque (HEK293, His)

CD40 Protein, a vital TNFR superfamily member, lacks conserved residue(s) crucial for feature annotation propagation, indicating unique structural attributes. This distinctiveness may influence CD40's functional interactions within the TNFR superfamily, underscoring the need for further exploration to unravel its specific roles and regulatory mechanisms in cellular signaling pathways. CD40 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD40 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of CD40 Protein, Rhesus Macaque (HEK293, His) is 173 a.a., with molecular weight of ~31.67 kDa.

CD40, a crucial member of the TNFR superfamily, is characterized by the absence of conserved residue(s) necessary for the propagation of feature annotation. This distinctive feature suggests unique structural attributes in CD40, potentially influencing its functional interactions within the TNFR superfamily. The lack of these conserved residues underscores the specific nature of CD40 and emphasizes the importance of further exploration to unravel its distinct roles and regulatory mechanisms in cellular signaling pathways.

Immobilized Human CD40 Ligand at 2 μg/mL (100 μL/well) can bind Biotinylated Rhesus macaque CD40. The ED₅₀ for this effect is 6.431 ng/mL, corresponding to a specific activity is 1.55×10^5 Unit/mg.

• 
  Immobilized Human CD40 Ligand at 2 μg/mL (100 μL/well) can bind Biotinylated Rhesus macaque CD40. The ED₅₀ for this effect is 6.431 ng/mL, corresponding to a specific activity is 1.55×10⁵ Unit/mg.

Rhesus Macaque

HEK293

C-10*His

NP_001252791.1 (E21-R193)

707749  [NCBI]

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCSESEFLDTWNRETRCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGLHCMSESCESCVPHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETKDLVVQQAGTNKTDVVCGPQDRQR

Approximately 31.67 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.