1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Stem Cell CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. Integrin Associated Protein/CD47
  5. CD47 Protein, Mouse (HEK293)

The CD47 protein, also known as integrin-associated protein (IAP), is an immune checkpoint protein. CD47 binds to membrane integrins and binds ligands platelet reaction-protein-1 (TSP-1) and signal regulatory protein alpha (SIRP伪). CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis. CD47 Protein, Mouse (HEK293) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD47 protein, also known as integrin-associated protein (IAP), is an immune checkpoint protein. CD47 binds to membrane integrins and binds ligands platelet reaction-protein-1 (TSP-1) and signal regulatory protein alpha (SIRP伪). CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis. CD47 Protein, Mouse (HEK293) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with tag free.

Background

CD47, also known as integrin-associated protein (IAP), is a transmembrane protein encoded by the CD47 gene. CD47 belongs to the immunoglobulin superfamily and binds to membrane integrins and ligands platelet reactive protein-1 (TSP-1) and signal regulatory protein α (SIRPα). CD47 is involved in a variety of biological processes, including signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cell self-renewal, and immune regulation. In addition, CD47 is also important in memory formation and synaptic plasticity in the hippocampus. As a receptor for SIRPA, it prevents immature dendritic cells from maturing and inhibits the production of cytokines by mature dendritic cells. Interaction with SIRPG enhances cell-cell adhesion, T-cell proliferation, and T-cell activation. CD47 positively regulates FAS-dependent T cell apoptosis and inhibits angiogenesis. It may also be involved in metabolic dysregulation during normal aging, regulating wound healing and stem cell self-renewal. CD47 may play a role in cell membrane transport, integrin-dependent signal transduction, and prevention of premature clearance of red blood cells. It interacts with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and fibrinogen. Activation of the CD47 receptor induces the proliferation of human astrocytoma cells through an AKt-dependent pathway. CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis[1][2][3].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse CD47 at 10 μg/mL (100 μL/well) can bind Biotinylated Mouse SIRP alpha. The ED50 for this effect is ≤1.14 μg/mL, corresponding to a specific activity is ≥877.2 Unit/mg.

  • Measured by its binding ability in a functional ELISA. Immobilized Mouse CD47 at 10 μg/mL (100 μL/well) can bind Biotinylated Mouse SIRP alpha. The ED50 for this effect is 1.14 μg/mL, corresponding to a specific activity is 877.2 Unit/mg.
Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

Q61735-1/ADQ12919.1 (Q19-K140)

Gene ID

16423

Molecular Construction
N-term
CD47 (Q19-K140)
Accession # Q61735-1/ADQ12919.1
C-term
Synonyms
Leukocyte Surface Antigen CD47; IAP; CD47; MER6
AA Sequence

QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK

Molecular Weight

Approximately 25-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD47 Protein, Mouse (HEK293)
Cat. No.:
HY-P74289A
Quantity:
MCE Japan Authorized Agent: