1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Epithelial cell CD Proteins Signal Transduction-related CD Proteins
  4. CD53
  5. CD53 Protein, Cynomolgus (HEK293, His)

CD53 protein is an important member of the tetraspanin family and plays an important role in immune response, cell adhesion and signal transduction. Its research enhances understanding of cell membrane organization and function, with potential applications in immunology and cancer research. CD53 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD53 protein, expressed by HEK293 , with N-His labeled tag. The total length of CD53 Protein, Cynomolgus (HEK293, His) is 75 a.a., with molecular weight of 19-22 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD53 protein is an important member of the tetraspanin family and plays an important role in immune response, cell adhesion and signal transduction. Its research enhances understanding of cell membrane organization and function, with potential applications in immunology and cancer research. CD53 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD53 protein, expressed by HEK293 , with N-His labeled tag. The total length of CD53 Protein, Cynomolgus (HEK293, His) is 75 a.a., with molecular weight of 19-22 kDa.

Background

The CD53 Protein is an integral member of the tetraspanin (TM4SF) family, underscoring its essential role in cellular processes, including immune responses, cell adhesion, and signal transduction. As part of this family, CD53 likely shares conserved structural and functional features with related proteins, emphasizing its involvement in the formation of tetraspanin-enriched microdomains and interactions with other cellular molecules. The classification within the tetraspanin family underscores its specific designation within the broader context of membrane proteins, providing insights into its unique contributions to cell membrane organization and function. The study of CD53 contributes to our understanding of its role in diverse physiological processes, offering potential applications in immunology, cancer research, and a deeper comprehension of its broader impact on cellular functions. Further exploration of CD53's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.

Biological Activity

Measured by its ability to inhibit chemoattract of Jurkat cell in presence of 40 ng/mL human CXCL12. At a concentration of 0.001 µg/mL, CD53 Protein, Cynomolgus(HEK 293, N-6His) effectively inhibits the chemotaxis of Jurkat cells.

  • Measured by its ability to inhibit chemoattract of Jurkat cell in presence of 40 ng/mL human CXCL12. At a concentration of 0.001 µg/mL, CD53 Protein, Cynomolgus(HEK 293, N-6His) effectively inhibits the chemotaxis of Jurkat cells.
Species

Cynomolgus

Source

HEK293

Tag

N-6*His

Accession

G7NW46 (E107-N181)

Gene ID
Molecular Construction
N-term
His
CD53 (E107-N181)
Accession # G7NW46
C-term
Synonyms
Leukocyte surface antigen CD53; Cell surface glycoprotein CD53
AA Sequence

EQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDPNVEGCYAKARLWFHSN

Molecular Weight

Approximately 17-23 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD53 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P76806
Quantity:
MCE Japan Authorized Agent: